ELF4wl4 (44/+/+/, /,%Lf/P /P/usr/lib/ld.so.1P;"TB'" ]Fm;^!4H^@|{xc[lJk~fQ"b Zd*w=:&lo7U@AKlYXK*5>]W  FukY`T 1 R)jw+_lm8a|O>1+@U}?HrjPY&>e)CGT I73N<sXp5\+ k4,K W0gsQrG0]VVni@eoA=(jc .6\]UhBgpUv'x-G~)=w-$#TE7%M5DfnRz6(~".=2}?f*$u[8is_t<IhB83e%%L7 X_LAS:%M[0pS"4Fyjk/iWx N/R`!xvLEvs-IT?8MznwK-<NOns8_ehfp`^=BV,;drzuqy6dEZFW|,.#(o96etPUD~J0HqJ:aotc r%O ,`/9-vpk MXq mOgJX/IZJ2Q6C)\' &A.\:u@Q{'tl| *m!\gzZ>b-Y$2 :eRR6y:9 i1MgL xL[(&'wyY~EH@m)_cV&*iFX%=,t|{0o5jHVw2?U+SmG (haA`}1pdDrqnbz1fF9/>qchN C\H ]W}P$O;'g 9<!y4`v*fkW1<r!+KSEq7$aG Jj/{Do8;L4s3<;[G n(v5aSON[Q}u"YA+QC0_>cM{y iZR|bBb,^#2?uD.!d^CB IdE{l#9)3Cx3zZb2^tKI3D?5N&T]#$P.}7#V4hS~Pa  /@@ \ p /, /P / 5  Td Tl Tt Txp0, 4(35P?@Ot_pp0|< ,dpX\8Xo<<< H* <H`M<dhv#4y%P30szx 4U) SH2`J[DdiH| `pDNB|td7 y$9\4Q]A|<j0$<\H[<0M ,c0 \X 3 38,L 4S!X]Tyh .( 4L<0 B, 1Tx,'_d8B<Z8n HYT<:IT`4\,4$/dh;\KXc w 0|4  0@<c(d,\ 2*,5  0"$ 6K Sd tc:t x$]*$> 1E]c0p 7Lx>D,e@pD[X| i  o@  $Q@ ,dDH 7]  ]|d j x] lP 0  Wp8 1 ] >,  2 !0` 3  Oz$ g | s4   X $p 3 0  [@  Vp $  p .t EL Q h  {9$ AH   D 2`  ^TP `(  1\ ( 5GD@ Kd \ nP  2 ` BL 2T X y   T 8 8  ' 6H FX TXD o l y  l    , @ P \LD 5 4XI YZ8spxYpC0TDl 8HVp [ P,.l DlT 4|[8fxD4 p@!h0PXpX SL$ :I 2QAg=y` \7P,Dx`P 2<$ ,-=}Q /, gHwd[8B@\,( ,D4T  d :lKW~|j,s@$PW4rDDF$D'6 HH8T,`ex ` 888tDr, $X l!x3hI 4O; al}t 4 $<4LZ <X  T8>#dLl^Ԥ nd u0{d@@ T4H8 14T6<B 38H(<X[0mw\==8;  3 $, Q  4LL4% 0 ,`|8C0GX]Jd wۄH 0,Ԭl[HGZ|H 3D\2P(`9H8LfzI4L\l#"9 5,F][,q#0 _ b<T<<HD$ D$84& 3/Y|7CH@Ry cktp\4u4$,p D P tP2hw4a8 I#T[$l|q8LT4X 2X(  2H"\9ƼL=aOXws,H  0H$, , Tp8'8C5d8\=,r~ 1,q;T*0D,̌3G,W|cC8\y P8D8$8P\,7BTVpjq} ,d_LXP5`(x,  2   %\L ?d  U5  k7d | El - t /<  ld T! 4X! !+Fp<!E8\8![!i]L!ZH!<T!@ !hD!4!q!H!0! 2$!0T""(E"><"R"ao4 "x 3D"~|""/H" 44""h","^8#\#@#'#;s#PB#f#{ 1@#7#U#oh# 3#s8##+|# 3P$l$uH$!8$0pP$A7 $R=$gFt$ztP$>8$ 1($$#\$$$D $4($B@P%4%c%#A8%BX8%`0%u 1d%zd@%b%Z@<%D% 14%|%,%D&  &&)X0&=I&SP&b4&|]`& 4H& |& &||&p&c@&ZL'8'"W':'MHT'c0L'rJ': '8''e'X''d ( |( 1(X("G<(;DT(O|T(eD(v_(P(D(?(b\([`(D(l(E,()4) $P)3tp )J 0)Q)a4)t~0);)T))%H<)  ))A)\* *JP*- 3*44*Gɐ *_d*ul,*UL8* *`*|*,**+a\+8d+#D+< 4+E 2+N,+Zp$+y8++}d++<+4` +d+J,",W$L,/T,B,R$,p 4,v@,F` ,,p,,, ,D`,DP-`L-͸-" 0-)-6 1-=80-J-Za0-md-w  -n@-W -]8X-H-<-q-x.w.8.6 4.>P.N .\.h8.u8P.<.H0..l.߸. 2x. H/  /P0,/0L /A /ZU4/o 4/v@8/t// 1/HD/8// 0x40 40"(0*>L0D |0J3|0XP80fdl0y$@0 0300p0,04l0< 0<41 /P 141!v1.`1:/ 1Jb(1VZH1c?L1{1l81<l1Yt 1;1\ 11@242$+2/ 2;$l<2O0x2aotD2v>p222b,\22 282Q2[2A@<33(6(37z`3I43\`D3gL3| 43\03Y 3 13`03x<3r8 3`D3H4 3\48 4#Hh41[4HXp4R04`|$4j\4w\846 4p4 4Y<4+H4 5p5 05"ܤ52$85C3@H5S p@5Y9,5lH$5H5Cd055.xL55X5lx5T5:66$61l6= 6CH6L6bT6xtD6d6<06 6=|66H46Ҝp67М,7$C877|d7A" 7Oq7^[ 7n\ 7{ (7d7װT7D7t47P 78 ˈ8 t8$YP86x|8L,8` 48f$8}\8 18[P\8H$848T8,`8 9 9!98 ,9G,89V 9fJ$9}px9xL9^9@x99ŤT99 39p:I@(:"$:1A:B 3:H`:YHd:kLjh:v>(:D: 4: 2:(:::x|: ;L;l ;%;8;He;S;e ;sƼ|;~8;<;;;58;;P< (8< o<'4@@$>!qx>*`>:p8>H>[ D>f6h> ,> ><>, >I8>PH>E4?L? ATl?$l?'?94?G]?o8X?l0??,?P?E?@d?tILeI[8Il^,8I8(I\|4IULIhI ITJ J4 J4 0J;^|LJQψ8JbJt8$JTJPJ]PJ 0tJdJtJ:K K"H K;l$KMKV̐KfXK{K0K Kp4KK]pK;K(LD@LPL%.DL9LKTL]] LqX8LLG@L LL4L 4L|L=`MdDMpM* TxM1 /MKptMcs\8Mt 0hMz:M 2lMMD0M;M M^dM?pXN|N cLN(N/4DN=zNHs@NU7NdNv<N0 N0N 3tN 4pN $NF0@N5$@NOO<OO,p\OB 3OLH0O_ Ox O$8O<0O hO OPO OV8P 0PJLP̜ P8XPHPYPe`$Pxo4@PP PtPGDPHP@,8Q|Qph@Q-Q4oQF>QTQl,Q /+ Qp Q(dQYT<QEQ=QHQĘQ 2 Q.PRHRR& R:tPRQsLRXɜ Rp `Ry8 R]0R<R2R RdR\RCDhS<8SC0S%AS0S>HSNt0Se$ Ss 5 Sz>S\S\0S$SHhS< ST Tl|T)T,T> ` !TEYTZ|(TkT$T}CP8TʰT1HTNT48 THPTxU < U! U&@U5T$UL "* !* > > "0 : ""#<㿐`Б.`   0 `*`:`` *4`2 "#0, .  g"  0*b, . @  #@  Г.`@ ⬕*  * " !*`#,   (`!"("!*`", "@ P.` @ $@$@ Г.`@#a"* ",  : *" !a*`#,   (`!"("!*`", "@ P.` @ $@$@c0, .  8@  #@  Г.`@ ⬕*  * " !*`#,   (`!"("!*`", "@ P.` @w $@$@ Г.`@#a"* #0,  : *" !a*`#,   (`!"("!*`", "@ P.` @= $$㿐ch.   " `*`:``*.`,"#,@!ch.   "!H*`!  J."@ !ch.   ( 4" "! %* #.  a@ c*$a"@ !H " @# J@`" $ch.   " !!H*`!  J* /"@ !ch.   ( 4" "! %* #.  a@ c*$a"@ !H " @" J@* `" % 0!ch.   "!H*`!  ,J."@ !ch.   ( 4" "! %* #.  a@9 c*$a"@ !H " @# J@`" %ch.   " !!H*`!  J* /"@ !ch.   ( 4" "! %* #.  a@ c*$a"@ !H " @" J@* `" %#, 2  ? 0 *  "* 0, : ""#<㿐`Б.`   0 `*`:`` *` 0 , #" `, . @  #@  Г.`@ ⬕*  * " !*`#,   (`!"("!*`", "@ P.` @ $@$@ Г.`@#a"*  ,  : *" !a*`#,   (`!"("!*`", "@ P.` @_ $@$@!0, >  `~"  0*a0, . @ @?*@#@  Г.`@ ⬕*  * " !*`#,   (`!"("!*`", "@ P.` @ $@$@ Г.`@#a"* !0,  : *" !a*`#,   (`!"("!*`", "@ P.` @ $$㿐   # #h  -   2   h@7??"b! 9!!@|@&  @! #a  @ *#a !$a a@u   Qa! &@   #h- @`#h*   $@ *   ch-   Pզ Ԁ "  K =I"G!6 @d!7 @  ! ! @"#h- @ ""`8#- "  ! ! "@ch-  " 8y?|,`"Ȁ` *`! ! @  c   ` T"`,`V "*@c  K@a  F! ! @&@ 6@R M? `&"`"*@9  !@7  ! ! @&@  @( K? `,` #hJ *%@@`- @  ch-   (  Đ@!"- @@: &@`!H-`@"@"@!"@ޒ@"-   @  @?0@ƒ@ǒ`- @  @&@&@@#aH-! @ $@@@#h- @"-  @ `(@$`(@ -aH-! "@ # " <+#h- @!H!# "# %a*   "@ ( a "@a* -  a@ a*$a&  @& `"- 4 #-  ?`  "" ! ! @"@  #h*  " 8 㿀 ' ' ?"H#h ,,@ $*  @" ,@ , ~ ,  :<',h  $쀢, '#,)h !'; "!Hh@  P"` Ԁ "-  'bHQ =!bH!6 bH!7bH#h`0&`8 2z`* ?t&bH@ `%!@H*   @:`(J@`" `"@!* @ @!*$& @ "@& J@`"%G&`%!aH*   @J@`" `( `"@!* @ @!*$& @ "@& J@`"$`%! `H*   @: `(J@* * : `" `"@!* @ @U!*$& @ "@& J@* * : `"!`%!aH*   @`J@" `( `"@!* @ @)!*$& @ "@& J@`"$`%!*`H*   @: `( @* : `k" `"@!* @ @!*$& @ "@& @* : `P"%!aH*   @` @C" `( `"@!* @ @!*$& @ "@& @`)"`%!H*   @`J@" `( `"@!* @ @!*$& @ "@& J@`"$`%! `H*   @:`(J@* * : ?# ?`" `"@!* @ @y!*$& @ "@& J@* * : ?# ?`"q &(&L&h@ *` 4<`<"* 8  @ɒ$`8! !!!@`$!a@O !@! `8! "``8  @?'?'" $`<`',h@  $쀢 ,h `8? "`8`<? " ` !@@t?'`*'㿐N +! @!! 4,!  "!!! a 2 "aa ` "a` `!h@*`%% @& !.   ; ::: : (:(0:08  :8 *`"*`#h@`Ā $"`4  "@ 8  ` #h*`@`   բ !#h`,@,`` @$!,` ,  @"$&@<,` . %!,`@``   @ɔ .   % #.  "   p"@,`@``(  ,` ( 6  @,Ȁ "@ n?, !H" # # " ,``( 6  "`(/@/@  *!,` `"@ . ,`@  ;::: : (:(0:08:8`"@.   !!. @?%  *`,` . ,`  ; ::: : (:(0:08:8`"@ ް @*6`   !@ @0!"Hต,`  ; ::: : (:(0:08:8$*,`@*",`,` ``@ #@ @# "b  "  @ ""#h",`  $`@ @#"" &! " ?"b!" @b$"" !@"@*  $" @!Ё㿐N + l " "@ @o"Ѱ?ƒa Ȱ"8_" *` P*` Ф@b( $"b(" `  В*`@` ">   | ;a ","#, . @?* ` @. . %$.  a. $. @@%``  @@3 .   $ "p@@?0b. "`".   ;@ ::: : (:(0:08:8( "(. `@ "`܀ . @.  `*` "@.  *` &   %  +  "<"8 @@ ;@ ::: : (:(0:08  :8b "b 㿐b( $"b(" D# P/ ","b * @b * @  Pb * `( ` b +" b   (b *  ܀@ b  @j b b *  ܐ @  @Y  b "@ <b ?b *܀@b ** @%@  @b (耢@"4*# @ ԰?b *` !*`"%@" * @!`` " *  @ - " * "@*#XU b *`@ " @  "@b *  : ::: : (:(0:08:8$ b  "$b * " <" 8 ( "(b *  ?܀@ b @b *`@`*`  "@b * @@ b *`  "@b *`#x @ ?0[b Й*  ?*  ` @b  " b *` @ b * @ @ b *`@ "`!" *`@  @`" *   b @@ " *`@ "`@ c#?b *`@  @`b * * & #, "  $b " ؁ B  …B#dd#  #ddȉB B: : #㿐 @fb#Ȁ /!!@]!"c  @Q!#h' ,` $  #h@ $ ,`@ @3`$&`ༀ@  0" @ @+!"c$" ! @#h+)',` $@ b@  * & $* `ༀ@  b "b#㿐" hb 6"b" ' %#"*   "@$"b@ """!"* b  ""@$""@:$"  6 "!3"#h @,@b:$ , $6" #h@,`, &  $` ߠ@j` "`㿀"  @'.``Ж 8  "8#.`""'.`А  $쀢6` #.`% "#,'9", P'@ P Ԁ "  "TE =">!6 9!7"<@"@?$@ '@%@$*`@* "@a* @@@ ( "("@*` "@ @W%%$* *@`"* @@@( "("@*` "@ @4% %$*`@: *"@!* @@@ ( "("@*` "@ @%%$*`@: *"@a* @@@ ( "("@*` "@ @%%$* *@`"* @@@( "("@*` "@ @% }%$*`@ ?*"@!* @@@ ( "("@*` "@ @[%Y%$* *@`"a* @@@ ( "("@*` "@ @%% $*?# @ @:`*"* @@@ ( "("@*` "@ @Y%  %( ]%@@  #@ ?'`<@ "< '.`@ $쀢 `" @ S.`b$ "b$㿐      )#h  ,  " @  6   @㽐`  `؁ B  …B'@큒@톒  !  @ %? 㿐 @ #?` @  0?"$" İ 㿐"  @ X?` @ ?"$""( 㿐`@ 㿀! Ԁ "@ $ Ԑ @ ` ް? 8@  "`  @Œа?!  `@   !  ؁ B# !! ! B!  a@! !?聩 B  @a  a@`8 ! "  DB'@  @a " @l!  @a   @|a( l%!  . @ Ԓa0@ @l  $ @ea8.   # . @ @`$@Wa@.  @OaH# . @`ԒaP@G  4 0` @?aX. @    @Fa`  @1ah#. @T > (#\` ap , 0@$   " @,bh ` @a @a( *  㿀'D'L!'! Ԁ "D@ $ D @` ?L L @֐!?@*`   @̐!?L@ B51',`@@ I &@쀢`H&8 I$ `    ! "a "$7 ? B5,`@$ᘢ`L@ ǡ,` 8D@  ,"` #@zD@믐? !@@qD@릐? "(@i@@랐? "X @ ,` ",` "@ @W?@댐0z#\  c@DL@c c`?  $%?D ! #`? B!  a@F #`? B  a@9  a@2! !! "! DB'@A  @a! " @!  @ a   @a( L@,`'! Ԓ#P@ @ `L@ ,`@   *  *   *    *  *  㿐 a   #h@+  1 Ѐ ! @# !#!@  Ѐ N# #2#@ꨐ#c J@  *@J@ "*@1#㿐 Ԁ  @`  @d#?㿈 @洒a 6' 㿈  @?聩 : :`#Ȁ `  '   HB B:@  @) ?㿈 N , @k '@k  #c `P @K'l@sc"`#a ``  @?!@a' ąB/$ N " @D , @  "` `@F  "`  ,?  p@Ӓ ?` ąB"` 㿐@ @`    @c @`㿀   $% !   ? : & '쉠 ƑBF ! B ƉD''@齒 <@’ <@鶒 <@黒 <  ! `@顚^1! `Ȕ@阘U1  DB'"'쉠 ƑBF ! B ƉD''@ <@鄒 <@x <@} <@q @v ` "`@ *## @Pa##\! `@D1!   ؁88x   !  ??N "  "  "  " ?* : `#*` !  a @ ! B 聠 @'1@ߐ !  !@ѐ ' B ؉ ‰Dz'#Ȁ  @`p j"$@貐 f@Ԓ @ϒ / @ܐ`" @蝐 ``DB'`" ,`* "@*`" * '腠FB'2 @n?@蝒 :   F@a?ؐ@萒 :  @X  a0 B !(؉DD@a( B؅F腠D ! DB'( t 㿈Ő!?"0'셠 !H aPĉBFB'?'"@%?!B'셠 !X a` !hDB'+  *  *  '썠'셠 !HDBF'& '셠 !pąB'썠"DB' "@?!? $?1# @ےa8#㿈@ /  @ / "b @緐 `4[ @簐  4T @穐  M  ' ' '쀢   !xDB' 셠 !D !DB' "'셠 !DB'*` * * "@@ ? @ aDB !DB' '"  h* "#  B#d d D DB#dd# h* "#  ȁ B#d d B ЅD ؅DB#dd# h* "#  B4   " #dd ā#  h* "#  B4   ;`` F DB#hh#㿐3?!"!"a""# #`  ::" """a"" "!@$" ""!!  @椢 "a"!$!#h,`  ",`@$ ,`  `@$ `,`㿐 " @1 / P` ,` *  "`,` ( ,`⬡- ",  ,`  " @ $,`@z`" @ ؀`㿐1!܀ 2  @i" &!1# @5 4#  b @7@V# ""a" !J @ 1@(!J @@~! @:"H 1# @ #  bP @`@'#!܁㿐@\"a܁   㿐@ܔ  @1!㿐@Z@W*  * : 㿐. ?c 㿐. : @V. > @R㿐> 㿐" """  @@夐`2""㿐 `@\"D @ Y*`: L@ "` "` "` "`  `L@`; 4*` L` /2  L` /2   "` @勒   $@ @儒   $ @"h ?@O?@v$@$ $""L@ `L@  @ lppppppppllpplpppppppppppppppppplpppppppppppppppppppppppppDl㿐  `  "  @" ";"a!!ܐ  @佒b  ".$!ܒ @    @@!@ɐ` $! "$!!!ܒ @!a*aܐ@J? " "@䖐㿐 ^N Z@䓐@ L@ /2@N /" @ E!܀ @"  $@@俔 3  2@g!ܤ@o   @8"0 @haܐ :  ,  * * !a؀2@S "!U㿐"J"耢  1  b    @Cc1"㿐'H'L'P'T'X3b@mH  !  c(@b@d 㿐'L'P'T'X  L@0@V㾐! @#0  @c8 `@ܒ#0 ` #& `p"# & `" N@   L   ! c(@ה ! c@@ϖ! @ucH!0" m" / /"ۢ ;`쀤@71"̀`%2(  L r2 @㔒#@バ@ ϐ 8 L  r2 *`: ?@r#耢&#@〔@,@ ,@ `L  @ Ѐ`%@L /,@`@R@@M4 c(@Y! c@@R!! @b @? cP@A! cX@:!!@ ! @ےb g2x 㿐 А *`:  _ ~ /   ` N?N 2 㿐N  J@ /"``J@  / @ǒc0 #@ 㿐!  @$ P  # @#  J@ "@⺐ "` c  @⿘  "@1@? @w! "`㿐 3 N /@ *@ @p !@k 1  @@F ` `@z    2`#@MP S L O@ c@k@'  c@ @ܐ#Ȓ@W@䵒 @+@3@  В   @    2 逦 @@ǐ @@@k@ܐ@㿐 1 L -@r @#Ȓ@ @i @ߒ@ @   @    2 @㿐  " @  @@֐㿐  @Ȑ g eM a@᱐ @ &@Ẓ& & & & ?& ' "` & 4 2 `@j  _`4& ` `s  & @S& ` @᫒  & @A@ᥔ   `  @7 @ 㿐`"   `"u @ "q J  `&k `@6g 2`` 2S`  4   43@` @@ @$'`@ " @" $` @  p `@ې@? ` @Ԗ `@` $ "@ @Ð  @@@@  `?     㿐   N@ w r "a  "a ` "`㿐͐`?"` 㿈  &  B "   @  & ?㿐     ?ܐ?2.?2. 2. 㿐@ 2 "@ 4   2 &@j "?" " 0" 0@" @ @ " @ " "      `?"   ᴁ?  ᴁ   ᴁ?  ᴁ 㿐  2 0 ` *` 㿐  @0H 㿐     㿐     㿐 2  @ 0 @0 㿐 @ߟ0+㿐 @07㿐  @0P 㿐  @0i 㿐 @0h㿐  2 @? "@  @`" @߻㿐` 2@J`@?  "@@`* "`  @ߢ@㿐@F 2  ! ) `: L /  L /  _ & 0 L  @  &@#  & & 㿐J (`@@k*  @%@6"`$"@X" @|㿐@U*  @R@@} `  @&``  @$ `$  @& $@. @@@@ΐ .` @ @P@6@@]`/  @"r`@`@ @ @ $@+ $ @ $0@x $& $@@}@. 㿐   @ 㿐   @㿐    *`(㿐  w @㿐  l @㿐@ϻ*  23@Ϸ3` #@&`` 1@$`  $ @& $@!@ @g@?   #@Ӻ D#  @Ӵ#d/#   @!@ @`@!`@`@` @"` @$ $@ $ @ $0@ $& $@q@}Y@ @*  @@P 4@L!@H"@D##@@@z 㿐@v@㿐|@  *`(㿐#cL .`@⥐@cL  !@@Ӓ@.`@啓:`* : 㿐 ` @9@xؒ * :  㿐  . @ @{ْ@@. > 㿐 ` "  @k’* :  㿈 GE`C@ݼ ? @      * :  2/  ah@-  @= ap#\  @< 5 @!@= @@${*   @  㿈 `'@  @@@> * :  @İ 0 㿐  `  @Ɛ& * :  㿐  `  @ᵐ * :  㿈 '쀦`@ǔ @ថ@ * :  @ 0 㿀 % @@@     ͖` #d#h#\#`a@i @ߔ@@s. > 㿀 % @T@@     ͖h #d#h#\#`a@> @i@`@H. > 㿐 * `'@/ "@M@'@@֐ ! !@@UN`  +J "*J  㿐`"2 @@Ґ  # @n@- ?`@ @  &  @X =@   @O`@㿐    " @@ྐ@ * :  㿐 ` . @@׽ ˒@@. > 㿐  ".`@@ۨ@T @@Ґ@f.`> 㿐`  . @@. > 㿐   G " @@D@ * :  㿐 ` . @@C ˒@y@w. > 㿐`  . @@^. > 㿐@ᓐ#L` @8! 1 /`{?@]@$   cL   @"!j?6@@% @!@*  "cL@    !@N?@ <{ @Y @ː# @e@}  @@Ò @@@ǒ `4@}X @O@M㿈 `'@ @ @Ȱ 0 㿐 "0 @@ܢ/b`!,` €, , !, (, ",  #L` #H@@m 4<LXl㿐  #L`, @Ԑ#h3 @ b@գ @@ݐ@M "@̽ @;     * :    @˝ @I  㿐   "  @ @** :  㿐 ` " @@P ֒@@. >  㿐@ ' %#} * :  2 @ʒ @ߙ@ђ @1@߂`4] * :  㿐   "  @@** :  㿐 ` " @L@ ֒@!@. >  㿐@# % #! * :  2 @e @4@l @ݞ@`4 * :  㿐  "  @B@-* :  㿐  `  " @@ԃ В@@. >  㿐@ & $" * :  2 @ @ː@ @5c@޵ * :  㿐#L` #0@aoi^] 3cL 5 @R# -./2+@@! "q  cL    * :   @N &&  @"#&S 2I02D@@ǒ *  2<@;&@@/@{ @J@ق @ܴ @@Ӑܐ@@߫@F @&`4 * :  2&@@@ ? @@|@㿐   "  @9@** :  㿐 ` " @@} ֒@@. >  㿈@ K IG * :  2?  @#  2 $    `(@%$ $#\   @Вc@Ò @ڲ @Y$ @K$  @ϐ!@Jf  $ #L` @L 8@`   㿐 ` #L`1 @6 P @U` x&a@ސ@  !% % % @% @9@@ 2 `8#L` @  p@Ґy   &`8&`&`@s&`@W*  "g @< ]+- , @ɿ@ cL א@ܒL @׊ 8$  $ 8$ $ @B$ Ԓ@&*  "6 ` ``2@ &! Β *  " ! @ *  " ` ``2@ * : 㿐@@]@Ʉ 2 `8#L` @w    &`8&`@&`&a&`W* : 㿐#cL   @\! "I?! `A?@}@D 6 @@'@A@  <{@@$ 㿐 ` @ڎ@V  * :  㿐  `  @8@,* :  㿈  ".`@'@_@t @{ڒ@@'@.`> 㿐 ` @F@  * :  㿐  `  @@,* :  㿈  ".`@'@@, @3ڒ@k@h'@f.`> 㿐 ` @@ƒ [ * :  㿐  `  @@,* :  㿈  ".`@P'@ϐ@ @ڒ@#@ '@.`> 㿐 ` @ٶ@~ @ * :  㿐#cL .`@ٰ@cL  !@ޒ@.`@ٓ:`* : 㿐 ` @D@كؒ * :  x`'`$``@`'`*`@`` Ѐ`@aЀb"##(#  @ c8cX "@H@v "@T'' X ąF@?pBch'@XTcp@Z  0@ co쀧   @ c^nc "s@վ "n@`@@# *@'' X ąF@?pBch'@cxc#\@=@  0@ c㐐@  @ c@ @cccc`@`@@}H@U    `@0 |3@@E*   1@O@, @Ȓ``,`  `p `@,``@,`*  `@q@`I`@`I2$,`'@C@I@`@l@ N `K@`@c@}0@*  @v* @ "`! @f` ' @ ^@ #*`:`@ & @@K  `@E@@@@ @`     2R@㿐4 !@ @ P ,.@! "!@ @ ! p@Ҟ  %O 9  /@N. N  .!(@҇   @Ҁa0   㾐 ,. @Ӑ!8 !@@͒!H@ǒ`p@W Ȁ " @d?.O @   @  㿐` `,.@ү@  @  㿐*   ܔ * :  㿐| !@k@K  㿈 #L`   !`  @ #\㿐#L`@!㿐 #L`!@!@@'*   A R@@㿐#L`@!Ё㿐 #L`@ߐ"#L @ِ"0#L @ѐ"8#L @ɐ"@ 75, 2  @H   H/+   #L`h@y#L`b8@#L`b8@ #L `@@` ``2@ 2#L B, 㿐#L` @x"p cL %4 * @ , cL @e 4 cL @["@cL @U" cL %4 *  , cL @B 4 cL @8"@cL @2" cL %4 *  , cL @ 4 cL  @"@  cL  "@ 㿐`2 `#L` `@"2 `#L` `@ ##L` ` @#@@  @@ #L` #h@Ҕ?㿐!$@    #@ 㿐 C@Я,`@  @[$@@!` ``2@ 2`  @5   ,#c@!,  &@U㿐 < Ɛ  6`* @ #L`  !#@@d<?  8$  `@B` @2@ " @  4` ``2@ 2  @ܒ  2 $  c@Z!+$ $$ @ 㿐 < #L` @ /$  ``@,@H  @  `@7 ` L 㿐 <cL @  @    2  <@ $ <㿐 D  !!   3 *   +    @  4  3 $`D#L  @     *`* ``*`㿐'L ! @@}?F6` CL   !!0@@l ,`" $Ő! 6 ,`+`   *@  #  @X@k`D$ "`DL !x@C ,`a$ @߈ $ 㿐 C@.`* @?L-2I6`," "@A! 6 ,+    *@ +@ " % @`L !@ D@ %@ @ L  !"@@L  L   2L   !"0@@ƒ㿐cL  @"p  *``@    2 @j`B$"`DL !x@ !!   @ސ  @ڐ   @֐! 㿐Β  !6`* `@`` @_     #L` " #L` "@W 㿐  6`* `@ 㿐@   @@`@ "<! @e,  , p@*#'0,@#* "@*`@*`'40p@5 @0 p@+ `D'L "@z@B @L #@d? !` ` L N@Ր#(K @ L E@̐#XB @ @Ő#ܰ?0>70  -4  *  ,  1 ),@,  @`$ ,,    ב4 j  @ X' @ 㿐@#@ t  㿐@=@@   @Џ @З@}0%@  cؐ@5 L  /d?@-@@e@c@m @Њ0@g @Є 㿈@ @@Ţ@  @Œ@C  ##\    @  ?㿐@m@@D@Ν  #L`@ # ` #L`@    #L`@ @ Ȱ 㿐@Ѳ@À 0C0@@[@  @Ϋ@?  #L`D! p@Օ@Ð0<@A@  @Α@?  #L`* ` @ 0 #L` @0@@  @l@?  #L` @@ 㿈@ @7  `#L`*@s! \ '-/#L`!!@@@b@ -@     * :  -6 -3 !p./! !@ @@Ւ@#@p*  !#\   D @  ?㿈@@ɐ  #L`;@!8 +    *  ""@)@F!@@2*  Ԓ?!#\   D @Ú  ?!#\   O @ͷ  㿈@4z  #L`@"  " #\    @͚ ?㿐@4  @i ?㿐@ԙ  @4  ? 㿐`  @=?㿐`  @o?㿀+  b8% j#\#`#d#h@@@Q@P!4#\#`#d#hbP⸔@#\#`#d#hb`@#\#`#d#hbxd@#\#`#d#hb㔔@ؚ#\#`#d#hbĔ@˚#\#`#d#hbȖ@ #\#`#d#hb⤔@ϐ#\#`#d#hb@#\#`#d#hc@#\#`#d#hc(㨔@#\#`#d#hc@L@|) #\#`#d#hcX@n#\#`#d#hch@bU#\#`#d#hcxD@UMcl#\#`#d#h@HMc#\#`#d#h@;͖`c#\#`#d@.#hj ̘#3c3#d#hȖ#\@#`㿀Q@#(@y#؀ F) !   #\#`#d#hc @-`#\#`#d#h @` #\#`#d#h @`0 #\#`#d@#h#\#`#d#h`@@{ 㿐㿐`P8@ 㿐!#/ X c@p" c@j#  c@d D#dc @^ 㿐!#`X%" >o@ >^@   @ X!#8 !-@w !.@q !/@k !3@e  @^" !1@W /!#  @O 㿐c !H @0* h pc,̖h@0 t㿐~㿐?c@!`@@ 4@!@"@##@㿐!Z#[#tb @ھ xX㴒 @ڷ  @ڱ 㿐#`x'#D   @ȏ !ߠ  w  @ȅ  w  @}  L F  @t  x` P  @j ! 4!ؒ   @_ M!P   @V !#ݠ آaH   @J    @B    @: 㿐#`x'#D   @, !ߠ  w  @"  w  @  L F  @  x` P  @ %4!ؒ   @ !#ݠ آaH   @    @    @ M Ȓ!P  @ך 㿈 ' @xx @x̐!0@x! %8 @x98 @w`X@w!Hx @wxဒ@wߐ!h᠒@wא!@wϐ!ؒ@wǐ!#!a!@w@w!" 08@wHP@whp@w"X⨒@w"ؖ@w"@w0(@w@R @û'cP@촒@J   #Xch@!zcx @@ǫ@J?`/c@֐@Ӑ @Ô@ϐ@+ @@'@ĐPb@Ĕ!@   @Hb``' P$@/@oJ;`/@ǚc` @. 0 㿈#h@Ǐ'쀢 @+/@*  (#x@3c @Ґ$ '#c@녔 _$@$ @g'@%쀢 c@쀢 2@@U#ؠ  @@꧐  '#c@Z oc@ @c  `@Ԑ@c @#L` 0c@@'쀢 2@Ec @ђ`h쀢#L`  p@@'@_@㿐@ @^@`h@­  - *`(@ƫ@8    c@ T "T`@ƭcL  @쭒@#@@껐@깐 㿈 5`"3 '@M@ƣ = .@` @X쀢 "@m @i #L` @v@K@ꆐ@ꄐ@ꁰ ' 㿐 g"#LN d??֑* : `NKƐ!l*` €#L(J$#L#L F$#L#L B$#L#L1#L ;$#L#L 7$#L#L$3$#L#L"#L ,$#L#L!($#L#L#L !$#L#L #L @$#L#L $#L#L"$#L#L@  $#L? $#L#L  @!0 N 2#L #L?$#L#L$4@P`p|㿐 L   #L`0@또!P/ @8  !pa@鶔 .cL  !@낒. !!@C  &cL !@n@邐 . 㿐 " #L`!@X @-@i8@   ?㿀 "<  "8 @F '@@k#L`"N @."N @߮@Ʋ@w@"0 "X& #\@ڐ@& `@?& 8@ 㿐 "9  4`"3 @Ӑ ". @ɽ@'@$#L``@"`` ` N@ b@ġ@@ `@& 8@  㿐   @ąb `@& 8@  㿐'L'P'T'X "   &  @֔L@8@  㿐  `"g N  a @*   "b@訔 c@1% '`@N@* `.@@B @G$  @J /b@5@$   ``2@L@ `L  "@@@T@Q&&@=@KL  #@-@ 㿐  0 @6 @3$@0$      2   㿐 `"; N@  5 @砒  #(b@  #@裐@i#@G#  @A>]X ?* : 㿐%X @1!$X  #@"(#b  >i#@ #  @>]X Θ?* : 㿐!5 X*   X  @ @ؐ"(@"$ X㿐! \ @$ \ \ ?* : 㿐!  \*   \ @ $ \㿐! ` @$ ` ` ?* : 㿐! ` @$ ` `   ?* : 㿐!4 `*   ` @丰 $ `㿈 a'`X \ "@ `` ^ @ @ :   *@`J@ "L@¯ L E``9) " @Ž 2` .`@”  @@   NJ?@`J .`#L`#`@菒 @棐/ ` ``2@ 2@敐X#%@J   @*cL` @l0    2 2@u㿈 '! \ ( b@%  \%'@   @L` @90    2 2@B!#L` d@# d O+`0p/-@(@#@$   J@ Z  @BL* `,@   J@ B 2`0 'p/t@8@@ " J@ " 2@ H &J@ "'l@yll'hh@̐   *@`J@ "@  @h  :@l'l㿐1 | 2 |@O& | |㿐! | "$ |@X$ | 㿐! | @8$ | |@* : 㿐 <: @  2 $ X`h@唔 c$ @@p * @`$@?$ #L` x@M #L` @B@3* :  㿐  `@G  @D$ @A$ ` ``2@ @* :  㿈`c'쀦 `cL   @ .: -+T)@歒@插`I   ; :L @墒%L@  @ @@I 'ؒ`h@ @ @@~  L  @潐 L !@洒    2쀢 @X@`'  #@ '*@@E'#L`!(@惒@= @8  #L @q!H @)ax@䩐 !@耢 a@4 ! #\ @d  a@䄐 耢 a@  ؐ@cɒa@j 耢 a@  А@cɒa@P ,@耢  a@٘  Ȁ  #\#`  #d#h@B Sa@  .Ha@ 耢 'a@4a@ r)a@ a@  b@     ` #L  "@喒 @'㿐E"a  #  N@ "4&  20& `| N@ ``|%& 2N@N@ ``| & @R @  @& ` `  & & @: `4  㿈/ 㿐@㿐  @  `| @  㿐 ?#L`@"0@߼ @$㿐 #L`@"P @߫?@0?㿈@v .    *  $#L`@" @⃒  2 "`h@!"l&& @^"! |& `& @|$ |"#\   N @ @~㿈 %#L`@䬐"Ȑ @M  2 "`h@˔!"l&& @("! |& `& @F$ |"#\   N  @p @I  "?㿐   ` "& `&   `* b  d*  (  6# 㿐 `.`*@: `  & `N  Ґ0z*N 2 `.`:  2 ` ` @   J@E " Ŕ  ` \:  N V R A* d @ J   @` *@  *` @  "` * @*@ `@  , `  &  #@ @ " "@& "@ ` `#@" & `.   `"R& ` .  㿐N@  @*`:`mN@`@ P.`>`&<b02N c0   *`c@Ғ0*`B:` 㿐N@  @*`:`ѐN@`@ 㿐 N@ò` 㿐  .`N .  <@(@ @$`B) N    ` # "`@ `B. .  >`B2N ߒ 0    Ô 㿐`B2N ˒   2  cI .`@C  >`BN  . 㿐 & .``+ ;㿐v  €  @@㿐 B  * 㿐ސ?㿐?㿐 @f 2 #`cp@!#@&& @$#P@$  & #L`@@⡐#@൐@a  & `А @6 2  #cp@ഔ!Ɛ  ????0 @ːc@u&&  & `&    *  B㿐Ř * 㿀3%  `- ֐#\#`#d#h @' Ґ`#\#`#d#h@) ֖ᐐ0#\#`#d#h@֚֔T#\#`#d@#h#d#h@#\@#`   Д 0*? 6*` /'P /'D` Д 0*? 6*` /'\ /'4 /'0` -㿈  *? 6* /`' 9㿐 Ƞ (  "  &  @& ȁ㿐N Ӏ .`:   ?#@ *@`& 0N Ѐ  ?#@  O*  $ J  *@`D& & % #{}_ \ Ȓ \* & Ȓ *-& ^!  ~!  |!! @1@  Ȓ@& <>2   Ȕ $* & * & *  * & ȑ,`: `   @/! "  Ȑ?&  Ȑ u@ 1N р  ( *@ Ȕ"   &  ̐ @.@ ̒" ٟ  ̔*@ Ȁ@  , Ȕ   Ȑ" (& & ́ 㿐N@  @*`:`AN@`@ 㿐 N@3` 㿐N ђ   . #L`*@๐!0&`B". р```"`# `$ `%`&`'`V` . ". Ѐ@ . .`. ҁ㿐N р  `B  #L`#@!H0 . .`. `. Ҁ``"`# `$ `%`&`'`V. Ё㿐!.` J &  Ҁ < >".` . ґ.`k. ҁ㿐  㿐  㿐  㿐  €ax{  @ @6㿐?㿐 @ݹ ԰  !a@7!!&& & $ (& & &  a& & & & & & @ 8㿈/ @p  㿐 @@f 㿐 @_  㿐  @H @ܐ 㿐  @= @ѐ?㿐 @X  2 "@bP@֔ W"&@n@& @ 㿐 ""c  #L` @ߋ x 㿐N ( 2 0 @  . ( 0`V2  @ڮ @ 㿈/ 㿐@Dڒ㿀N ( `V @֒  . (`VՐ .` €N "  ؤ N   N   $ "@@*N`@ " @B@@E@h 2 @@  @#L`@   N "   @   @#L`@  N "} `"y @ cL q@ڐ m N "i d  @ǖ   @^#L`T@޽!P N "L G  @  * N "; $6  @   @0#L`&$@ޏ!8" N " 8  @|   N "  ,  @k   @  N "   N   N   @L @@qN "N  `"N ''@' @ @ݖ @y @E'N "N $`"N ''@ِ' @ @ @Z @&'N " 4 " @@t!X2 @4@  t N " `" N  !h@Ȑ s N "N   @͖   @dN "N   @   @QN "N   @   @>N "N   @   @+N "# P  @   @  $`"  @V@ @   @  4 0@#L`!p@\ ( ,  & ,& 0" @LSSSSM SMSSSSMSSSSSSSSSSSSSSSSSSNXNSSSSSSSSSSSSOTOSOSSSSOSSQtSSSQSSSSSSPSSSSSSSSSSSSSSSSSSSS㿐N ( 2 , @p  . ( , ?,& , 0 А  & 0#L`"& 0@ڐ!& 0`B `V2  @׈ @6  `"   @@M @u㿐N ( `B @4  . (`B#.` E㿐N ( 2 $ @   . ( $`" 3  2 @㿐N (  @  . ( @B 㿐N (  @  . ( @@ 㿐N (  @  . ( @> 㿐N ( 2 $ @ג  $`"  @Β @ @   @@V 㿐N (  @  @ @ @   ` €@<?㿐 $  @ ԰ 2 "b @?"! && @& & @֗  & & 0  & & $@B& & 㿐В @;㿐 2@\ b(€ b0$ b8$ $$ @㿐 @ 㿐 @^ ,  "@bP@ܔ 6"b& "& & b!& & & & "& & $`& (@&㿐  @ٚ 㿐  €㿐  㿐  㿐   㿐  €㿐  㿐  $㿐  (  `    ⤁             ⸁         ā  ā 㿐    "Xbx@- S  $2  : @.  @  6 $?㿐  "?֒  (&  *@ #L` @"@ږ?& 㿐  ? *`  H" @: #L` " "@s ?& 㿐   @    `$@2  : ,  @+   $€ 06 @$@#L`" #@C  @ @ `0㿐#L`@@,#   &@  :`#L` @#( p&  H (   & @  $   %  :` 㿐  $2  : , @,  6 $ 㿐 @ 㿐  @  @t @ܐ㿐  ?€ @f @ΐ㿈    Ŵ@ $``ې!ē*` €,`  "    w & $,`:`     "& $& $=  & <   @ & $     @  t r 2qn ,`:` <    @  Z X ,`:` /    €  & $,`<`@$@v@  @ @ J? = 3 /0=  >2 @Ӑ  J?2 ْ  &  < €  @Ӹ @ӻ& $ ,`:` #   & $"a=  `@Ր@Wp ;< & $,`: ba  @Ӿޠ@@@}c8@     *` €:`=  c@   @c @f?=  ; & $"a=  ` @ӄ/!@H  #L`!#H@8@~ @5  #L`!#X@%@k{ @ߐ@k & #L`"  !#h@ @S @ @ (   ( H?+@ * #` &+@ @& ?&  & $"a=  `2;>"  & $ @"a=  `>=| @Ӊ@Ɛ  _ @ː & $"a=  `2>]=ڐ   & $,`: ba > '#L`G@#D " & $  & $& $ @җ"a=  `>  @A7@҂& @ҲҠ,`: `'`@/%@p & & $,`: `" `@ @a & & $` ` @҉,` : ba  @{@@: "  J "  @1 #L`!#@!@g @ @,0& $@= ?`>& a @`] #L` !#@@?O  L& $,`): ,`:  - "A  '=  >9 ,`:  " >2 ,`:  ' >+ ,`:` -   & $=  >  & $,`:  - & $,`:  -    ,`:  >  & $& $ ?    c0dhfhhi,ihibcd4epejLjjel`lllllm$mDm`㿐@ 㿈/ 㿐 @U Ȱ 2 #bx@Ӕ#1#&@1 @&  H& & & & $ "? 6"  `&   @6 *`   `&   @6 *`   `&   @6 *`  㿐 `  6?.  @Ԗ   &?     ?  `&   @6  *`    *J&-+ *JaJ@ 2 @._+-2` @* `J@2J@ @*㿈@~ @!#@  @@ @@`*   ̪  #L`@Ґ @@@x˰?`.@@Ԓ :` - @@@Ò : , @*   #\   K @ @ӳ@ӱ@E vtrp`0@͐ `8@д@б :3@m @Ш3cL`@@ӵ `H@М``P@Ж@Г@R  `X@ӝ  ``@Є@Ё 3#L` h@G?cL  `! @@;`3@Đ `@@s  `@Z@W@ >  `@N@K@  >@͐@А` #\  @ L@ϳ@@@ϭ㿐@@@#L` @ݒa@)@@ @ 㿐@  @@aȔ @4 #L`!@@!В@1@@@ 㿐@@Ր@#L`!@  @ж 0 "a@5!Z@͖ $$ $ ,@]ߒap@>@)@`,?@@@y@"#\   ;  @Ő|{@*    @  @@ 3@ИbX  "#\  J @3 ?t& @obX@@    @9@J  [& ဤcߐ?U& @@Ò|{Հ`j? @" d d?b @ / @ @  J@ <" @ @q  2  "a@$! b`@@ &  & @ *  &  &   & "#\   ' @ ?& @ @  N   h]|{v2?& @-"p& @)"@Ðِ @q@L|{^`` 2? @ d ܐ?ڐ?N  * |{C2?& r"@G@"|{4`` 2? @} d ??N   @*@|{`? @d d ? b $ @- ?#`"   $  " &   & ("#\    @ ?`& p N    b@Ȗ|{Ҁ?& "@ʈ & >. @ѐ@|{``D B? @ d :?@l" & 5& N  p ( & (`@{|{ ?&  . @@s|{` ? @Ғ d ? ( @?& . @ڐ"@n@@̐ @ H @ѐ@R Q @[@ @V@D0E@@ϐ  €|y2 `|{@|{". "€@|{  ?@#@|{`?? Ȑ ̐>l ~~P~t pDx㿈@@~'@ * c@c@ܐc(@΃  @  c0@ @㿐N@`"a @`2 *J "* "*@ @ 㿀L   L`` 2@,L  2,L < ( >.N > )2.N  2N.@Ȓ @  2L@  2`,@`L@ <"`@I@ L@ >", L  2L, "<#\L`70"aLL   2 ,@W?  N <` N >". @@@2 " #\L`a @`"'#\#`@ @ 㿐 ` @   #8cH@a @&  㿐 "-   #    #@1      @g @ &cL #X@@ 㿈 K`Ic('@U   @@Y@͟cx@E   c0@ '쀢 ( @ :  w`@*@@4#@쀤  '#L`#@κ  c0@ 㿈 \`Zc('@   @C@ @Ocx@   c0@b '쀢 9 @ :  w`@c*@@#@̉쀤  '#L`@i# #0c@C   "@U* >  㿐@@|{H@V"*  @X    `2 @`@ `` @` `@@, ȁ㿐#L` @ #  @ː@|5Q@ 㿐b'   N@ 23&`"/&N  2*. @* N `2  @?&  `"N  2. @* N `"    & &&!& @`* o&#L`@ͩ * N `   &  &. ` 㿈/ 㿐@g 㿐  @c @ˋ㿐#L`@k (?㿐`@  2  pcH@˃! D&& & ` @n& @] @W 㿐`@ܐ  2  pcH@Z! D && . & ` @C& @2 @,  @@g  p` @ @0`@,`C` >@"=@"@@y @@ . -@ѐ 2(@{i  @@`  `@   @@ @@@ѐ@ϐ#L`! @h@̮ P   .//////  㿐 2N -<{  `' `! s  @7@: ` 2 ` .   㿈/Ȕ 㿐@;㿐  㿐 2  @  @ @K㿐  ` €@ @<#L`@ ȁ?㿐 @ɽ  2 !a @;  $$ $ @Ɨ!$ , @/Д 㿐 @ɠ H  !0a@@ m  @ʥ`@ʠ @˵ $ @ʘ \@ `?$ $ , ,, -$ <$ D$$ $ 8$ @㿐 /.` N  @ & @  @&   & @` ``2@ @o  @i@ɸ  `"  @2`$ `@  ;`":  0" ( 8 " 0@ 4 <@ < " 8@ & @@ @ " <` 4 D` D " @` &"`$`"`$" D   $  H,2$ *`28< *`2@D㿐@  aP@Ʌ   L    㿐N`- ` @i  ` @Ʒ&` ` @Ғ     2 㿐N`- ` \  "` @ 2` 7*  ??0;`@`@  !@: *    @+  ` @!  @    0` , ,㿐N`- :&`4㿐4`4@ 1 @6$@6$&@ 4 @ - 2@  @  &&Ԁ@P`_N`, [@|`4@`  4 N`- 2```"``   @  *``"N`-@ €N`- 2` ` " ` ` @` € @ ` "`@ aX€@`€` ` @M *  `0a`@@`€    P  㿐   @z $ 2 !!pa@@!!!@<@@ $@@*@yĐ?$$@v$@x9.@ @ J : / \2@R   $ @$ ` $ @$ `!`  * `  (     V €` € V` € (`       " €` € "㿈  `\#\3  2    V@ 0@0 㿈#\#`  ՘  . -. ,㿀 ) `&@&*   #\#`    .  "' '쀢 2 @ǜ @J㿐 `" J@   @+ *  @0"  @ `?㿐 @@`  Z  ?4@0`  € Z &@& 㿐 ,      " @Ւ   ` ? 㿐6 ? > ,    N - "0  @N - 2) @ N -   "   " @Ɠ 2 `"   `@C" $   ?㿐  ? %  ,     &    ,     &    ,     h& 㿐@ & @`@W  & !a@@ "  @`L@L@ ` L @` L  .2 L  aa, `,  ` ,  &  * @ & &   *`,㿐 ? @(,`    @  "`@<  2    ( " * ,, , `@܀@"@㿐@` !!@ť 㿐@`  !!@Ŕ @" 㿐@ ``N``.N@  `.@ @N@" N`.`N@ ?`N@ . @w @tN@$㿐@㿐 2 h &#d     #| #    #L`@@!a @` 3@} #  `2@ `2  L  2  @*   @ ` @` @  "  ?    )`  €  * €`€@ġ @Ğ$ @ě$㿈 -'!!@Q '@L @ɒ / J   !!* @9*0 @4@0a@m'a@#Ld 耢!"(@B 㿐@p  '?"% @pN  @ @* : `@8@5&&@p&@p̐&@p` ?㿐 @ð   "0b@@.  . 㿐 2  @   @ $@$ 㿐 `"?@ !@` !@  @ڒ  * @r  2 ,@"Pb@@ ,@@`"@bh@͐`` @ǐ @U "Pb@@Ԕ @@@  "Pb@@Ô  "p"p, ,  ,  ,  ,  ,  @, cL$"x@}N` b@z0b@t@Ã@Á@ ?㿐i`? S@  .``2#N`B @ .` b@ N`@@spb @@HN`   N`  @ 0.`* : @@sJ?b@g@#0 㿈@i`?  `}" @('@@`S@+b M`J!#L$"@ے@ @#L$@ː" @@ %o$"F  ,@~@r1 @ @ݐ o ,@´@²"$ L "  @o `     * :   ?  #Ld?@x#?㿐@n  '?"% @nN* @ @* : `@n@k&&@n&@o&@n` ?㿐 @ ,   #8b@@d! , )$ 㿐 !  ? @?  @<$  @9$  @6$  @3$  @0$  $@-$ @*$ $0$ 㿐 2   . )& @. ( @&  @&  $@& & $ 㿈@@!  ` '#Ld@#Hcx@  '@c '  cL$d@ʐ#a  @ c@@qc @ BcL$@é#@?`H@ 4@\  @`$`@M`0'`X@Ԑ ``@ΐ @D0`h@Ő  @; `@I0 @`p @,@*  㿈@` 'N@ "+ N `% `x@&@#`@.`! @@@@  $@ *0 0 (0W*@2  ( 0 W((0*` Рp\@j@@obh @i@ې@c @_@ѐ@Y0@e@'` #`@@@@E @A@@; @7@@1@>`Pp\`@@h @ @@@``@ސ  0 @d@ 0@ [ @ @"h @@[@@ߔ `%O@ "" @J@Ґ @ΐ@@@Ȑ @Đ@6@@  @@hx `"?` "?@@N`* '@h@@pZ` &``@`` b ``Ȗ `А `$``Xؖ `p ``h ` p`````#\#`Ԗ` 0``#\`$#d#h#`` i`` c@@3  !b@@# , ,  ,  ,  ,  ,  ,  , @cL$! @N`* b@0b@@@ '?㿐i`? `@  .`)`2#N`). @ .`*c@BN`)@(@oc @4@jN`) ڔ  N`) `  !8&`.`)* : @@oi  c@0c @}@9? 㿈@i`? m`j# @='@Ő@`T'@>b NKcL$ !H@@ `@"#L$@ސ!h @@  -o,`* (.`)@@nE @ @ o` .`)@Ȑ@Ɛ `#Ld !`;Z;` @Q957+k#@Ԓa @J 2a'0_@ɒ Ȁ  @? V@4`0R@  @2 I@'`0E@X  @% <@`$08@aȀ @ /@aЀ *` &` " .`(.`)@a؀ @ @}`  #L$!@1? &` @ N`( 2 ` ` @j v     * :  i?g ( @9#L$@"@ΘP @@n g@ @@0=@@n %@ @  &@#L$@Ɛ"@0 < @@ʐ@Ȑ@m ڒ@  #Ld#@?㿐 2 @ @$㿐!"Ȁ @=$"Ȁ`" @Ò     2 2  #Ld @k"8 㿐 /Ӑ " @  2 "Xbh@~ a@b& & & & @cL$"x@@0#Ld"@80 #Ld @0"8 㿐 #Ld """ @0 #Ld @" 㿐  v b@cL$#@Y  㿐"Ȁ  I    2 "@ $"Ȱ 㿐  @q   #(bh@ @x& #Ld#8@0 㿐 `"  " {   `"   "@@M&   㿐 " _ "  `   "@#Ld#`@u@ @$㿐 #Ld3/"8cL$ #@Z  @,bؠ@a :  P`@1*@.  "##@@S  cL$#@3  @ @ @<㿐` #LdB>"8cL$ #@  cL$/ @W   @Ԓbؠ@  :  P`@*@.  "##@@  cL$ @@- @ @   @   @@Ȑ. :   㿐` #LdB>"8cL$  `@h  cL$/ @9   @Zbؠ@ :  P`@_*@.  "##@@  cL$ @@_ b@2 @@h. > 㿐@@k}@vא @U`" @ #Ld @0  ` 㿐@I#cL$ @ ! ؔ@ cL$ @ @@=  ?㿐@#cL$! @ ! ؔ@ "? `cL$@Ԑ!H@ɐ   㿐@ "  @P  " @ #Ld !p@` `>i 㿐`& @  㿐   2 @   㿐`"  @ 2 @` 㿈@, $ . '@ʒ& #L`@!@e쀢2  !ؔ@ 7    @ $@&     .    㿐$   CN  @=  *  2N ?   N@   .  #& 2 N@N  &  $@N@` `       & @ $Ȳ`" N @ @@$N  @^" @Z"8  @vY &  N  "& @fV   ?   " Ȁ     @g @s@@g "@& j&㿐@`㿈/X 㿐 @㿐 @R @l   " @<{ <{#L`@t"@@ $@㿐  ?` €#L`@\"`@ $@n㿐@ @ , 2 "a@p "|&& & & & @ʐ @& $?& (@l4?#L`@@/"㿈@$L "a Ȁ   #\#` b  @ !b @    #\c  @  c @ @@@$ cL @#@ݒ  €  ,@㿐@㿈/ 㿐 @㿐   @@㿐  ?@#L`@"`@㿐 @" ,  #ha@!1#8?&& & & & (& `& @G  @@& $#L`@@W#x㿐@@@i#L`#@C|z|w@d @  @?     @d! !?   |z|x|w2 ` € @@'  |x@4$|x@@ 㿈 `d `e" $ ! @Ѱ   $cК#\   @ϖ ?$$ c#\  ( @– ???$$ 㿈  d@ `"h*` € ?7`w*`"L €@ $  $c#\   @ ? @ $  $c#\   @ ? @x $  $c#\   @v ? @h $  $c#\   @f ? @X $  $c#\   @V ?z @H $  $c#\   @F ?j @8 $  $c#\   @6 ?Z @( $  $c#\   @& ?J  >Ӏ`g*`"0 €@ $  $c#\   @  ?0!-@ $  $c#\   @ ? !.@ $  $c#\   @ ?!/@ $  $c#\   @ܖ ?!0@ $  $c#\   @̖ ?!1@ $  $c#\   @ ?!3@ $  $c#\   @ ?А  >o`7*`! €@ $  $c#\   @ ?>o@ $  $c#\   @ ?>n@t $  $c#\   @r ?>m@d $  $c#\   @b ?>l@T $  $c#\   @R ?v>k@D $  $c#\   @B ?f>j@4 $  $c#\   @2 ?V>i@$ $  $c#\   @" ?F>h@ $  $c#\   @ ?6>g@ $  $c#\   @ ?&>f@ $  $c#\   @ ?>e@ $  $c#\   @ ?>d@ $  $c#\   @Җ ?>c@ $  $c#\   @– ?>b@ $  $c#\   @ !?֐>a@ $  $c#\   @ "?Ɛ>`@ $  $c#\   @ #?>_@ $  $c#\   @ $?>^@t $  $c#\   @r %?>]@d $  $c#\   @b ?>p > `r!̓*` €@J $  $c#\   @H '?l> @: $  $c#\   @8 (?\> @* $  $c#\   @( )? @$ @ > V$ > S$ @ $  $c#\   @  *?1>@ $  $c#\   @ +?!>@ $  $c#\   @ ,?>@ $  $c#\   @ݖ &?> $ $   c#\   ?@Θ ( ? $ $ l,l,l,l,lD\\44\Dl㿀 @a@m (c@  > ##\   >@ @ @@z @q? "` @&   . @w `@~*#L`9!  @w@gb?@ -'@''  & @ ` ' @ ? a#L`  p@>@ & c& f1? d #L` @(   #L` @  @ې@& @wT <@wP    #L`" @!  #L` @!@ @* 0#L` @!p@w&  @ 0 @ @@&   @& $ ' $@ '* @Ғ d 2J Ȑ* : C d e & & @ @%!@@@p `& 2!   " @ @!@@y@p `& @}:|.   !, @?@h_ @ @!Т@b@TJ Β @p 9!#!0@  @d @Ɛ!@F@8.@@h1 @!Т@7@) @E !@8  `ɀ @?@8 ` !@@4@&@o &   @& @ `. @ @@| 㿐  N & O`L  ` d2V @ @& @@{$@@.&N  @*`( & N@ & N@   &  c$@ `"`N   N   @ @Y @e@|Y$@ 㿐@s㿈/ 㿐 @㿐    @<{<{@㿐  ` €@t#L` @W"?㿐 @     "`bp@s# "4 $@ @@?$ " $ $ 㿐@@#L`! "x@b@! @’ 2 $   "bp@@#$ $ @kbP@L@7@J㿐`@?@@``   .`  "p#@8!#L  "Ȕ@```Ā#L  "@Ԓ`"N`@`&`   a8  @  .`&` 㿈`?@O@~@u &`E&`&`@?@d@yD 2   B  "#\   ; @s 42 @hʐ` ?X a@   € , @h`€!X !#聩  X@^ € 2`  ` D  D`k  p5!3!/!+! @i6 F  M @6 "I= @hh@h[?P   X  € ,@Xa`  €h!€!P `!#聩  Pa@ €` ``2@    @  @``  p/!+!`@h =``D`@ؐ "@4` x    € ,  @€`!  !#聩 ? a@ €    2`ǀ ``  <  <`(8@ #8%!`€@ € €`      2`2 8B4@= =4 +!))! ` a   € , ` @€L`  €! €    2`Ҁ  4 0@@a ! a €  0`"!@\"d! @` ! a€  €  @@ ! a € € "  L`j!9!Ѐ! a  #L`U!@"R# !! b0 € € "  L`2!"@@w. *@_d $'l !bh l@@  €  #L`  !!"@А@J! b  L`)!@4"&,! ! b € € "  #L`!#@,`*@@_Vd $'h !c( h@@}  €  L`  !!#@@j@@@ !pch@ΐ !cp €  .@b )'!%!€ `€@ € €`      2`2 -@i "(@Zd@Z@/ L ! c €  @@@~8! c @w:@ € € / @wT@ € €  @wn@ € € / @wj@ €  cL  !@&# 㿐 2N *<{  `$ `  2    0А 2 ` .   㿈/˔ 㿐@ǐ’㿐   @㿐<{ @<{<{@ @$ 㿐#L` !@#   "  `" ` €  @& @?㿐 @7 2 """ 8`H@"a" $$ $ $ , @  "!`X@I.:@^㿐 2 @ @|$㿐  &@#L`C"@Y h@    % ,` @I C  `̀ ,` C@  $"" `@a K̡,` 2&@@&@"@@@  ` ``2@ 2 㿈 .'찒   @  2 "" `@, i@& & & @˒cL " @0#L`" @0 #L` "@ߐ h 㿈 's#L`"  "!"! @Ĕ0 #L` "@!  㿈  'O찒 @cL "!@@3  㿐b̀ %  ̑*@       2 @B@B@ $̰ 㿐  @   ""!``@ @& #L`"!x@V0 㿐 #L`"!@G@Z @W$0 㿐@#L`"!@1㿐 !0    2 #L "!@@ڐ  㿐` %#L`,"( hL ""@"! @В@ :  P`@*@"@V"0@` L ""8@  @ @@㿐  %#L`;"7 hL ""X@ސ  "L )""@D ! @@ :  P`@*@"@"0@` L ""@   @]@`  <@t@@?* : 㿐@-@W@P  #L`""@T    2`n@   ` 쀤  㿐@ !#L`"#@.    2`H@   ` 뀤  H@  ///A9@~ < + ` "c8   € , ` @€L`  "cH €    2`Ѐ`      A @@ <+  ` "cP   € , ` @€L`  "cH €    2`Ѐ  `@'!"#`@   @h @L@ ""cp  @T @8 @@ "c  @: @ ""c  @& @  `R@x MA'=`J 9 %"a _J `2*J 2   € €Ѐ " L a J `2*J 2  €  ` ``2@`2@@ #L @ "@Ɛ# €    22 "N O 2N @ "N #L @ "@# €    22 N   #` @ @i #L #@~  㿐N  ` b . `2  㿈/ 㿐@:ܒ㿐 Ք  @㿐<{ @<{<{@G㿐#L` #@& P    ` €@/?㿐 @   ### `@4!# l&& . & . & @9 @ #@$` ##`@@` #@ ##`@ȁ㿐 ˴) ` `N@ @? `& H` 26N@$ ( (J`" (N@@2 (& ( `J`" (N@@  (J`#L @# $@  $  & (. & $N@ $& & (& N@ -   y& w v& s& *` 2N@  $ 2u#L @#@g & & N@ -   &  "L. & & H. 28N@N  "'   "#@#@!  @I  @` &   $ 12L -2   &     &  `2 &  `:: N    &@  㿐@Ր㿈/ 㿐 @㿐    @<{<{#L`#@Ȑ! @ $@$ $㿐  ?` €#L`#@!@@ $@$ $㿐@^@i @G#@U#@ƒa & @4 ,  ###!xa@ #a\& & &@& &  & @0 $ $& (#L`@#!@o 0 #L`@#@g!@)㿐`@/* :  㿐`@V* :  㿐@ * :   㿐! .`@Ɛ e$ .` :@@ 㿐! .`@ e$ .` :@@ 㿐` @* :  $$㿐! $ @$ $ $* : 㿐 $ * :  㿐` @! $ $ $㿐   @v@@ɐ@V@} , ` . 0@  " ,@@S  , @@ 2 ,@O2 I ?    Ȁ   d . 2 @y\3 422 ,@f*  ", ,@fŐ*  2& ,#@! cL @#@}"@f  ,@N  ?   cL @#@g"  , `:. 2#@А!cL  @0 @ @#"   @E  @^ 2& cL  " ` €     @&  cL @#@""؀ @`} 2&   " ` €     @&  @70*  $cL ,  #@k#  @^k & @  2cL#@\#  @^\ cL @H & cL @#@א#( @` 2&   " ` €    @ &   2 @g&  㿈@d@a //#L`@ ##P##h`##h@ %@@b  @O O 2 <  @O` 㿐 @$  N 0 "a     (  N@  "-   2S& (Q& ( N@   H& ("F& ( 2N@N@  2 :& ( "7& (5& (` @0& (` 2N 1 *& ( `:"  @   @M$@ @ . 1@}b  $ *`  @} e & $2 ``:"` @ "` ( "IN 1  " Z`2X` $@@" @ؒ 5 &@ " (   ` `` "` ,  ` ` "`  @Z @X . 1& $ >& ( " 2&`@{8$@V X@ѐ@@`$   @  #\`  @- cL @$@ `@  ((㿐@!  2 $$ `@Ԕ #&@z$@  & $$ `@Ĕ ' @z. & 㿐 @&@㿐N@@  *@zՑ: * . :@zw `N@`@㿐 @ 2 &$$ `@ I&㿐  *@ @i  *@ @Z @U 㿐    &@Ӓ  & $$ `@Q n * @.:g㿐. :^㿐 * @@   @yђ  L  2  @8 2` @ 2L   ?㿐@{ /P * @ "  L    @y ) L  2  @   2L   (  L    @@  L  2 @P  2/   2L  P@ې@|?  // /0;@P   -$-@     € , -@l@ €(-   GT C $@ 3$@ . $ a   € ,    €` ``2@  $@ ؀$@ $   3 h / @P  )$@h ؀$$@c $@^ $@Y $!     @xѐ @x@  1X - '$ @    € , ` `€    2`ဤ  @{ 9`6`\$aX  @x @xh !`$!$ap@  @   @xd  @xH@ `N.`D J$@͐!D@ $@Ɛ!@Ne $ aȟ€  ` `€.` $ $a `€@ $a `€`  `  2`2    $a @w @w p?!$" @tp  @w @w@ t?!$" @Xt  @wǐ @w@ " @Iܐ@J @j " @|{@K@j@K@K@vQ %$ b( € $b0`$b8@w @wj`@@C8 @j\ 2@jI@K@K@v %$ bH € $b0`$b8@wM @w1 @`@^  2   @K < $bP @w @w "N  $b` @w @v N  $bx @v @v   $@b!  @Yh cL @$@"@2 &   ` € @& cL $@͐" 㿐 @   @㿐@xm N !` &  @x7. `@qj@] $@vrbЀ  `Ӑ ). cL (@ x@fȒ "  cL  "@f 2 *@cL (@  $ @L / @"&$ /2J  ]   &$? &cL (@ cL (@  &$&?cL (@v! @a6cL ($@l!H$@M$ΐ& TX@㿀,'@`Ґ`?''5  8* @€L (@A!hO ( ܒ ڒ L (@5!@`@Q <{j  L !(!@`@ Ӑ @`@f~@`?L`(@!@$&' L (@",@s,<{=, N?L !("0@`o@ &L (@"`N )O ) L N2((""(" $@@C@d_@쀤<{'쀤? ?& n. @`}@SX<{ ? }   dO (    @e`"&N! "&&~?L (@" t/ 0L (@" $ @# $ (@e\ @  '(&"b@$(c@ed  $c@ $  ' $&@eo /  , $@ /, @B' $@dx  &L (@E#N (8В@O쀤<{u'쀤? ?& . .!@_@RȒ<{d  ?@e' d ? ?&. L "O )(@#@O )LN$@@iː@; @i@i@Em @`T@j  & L (@#h`@_@R}<{ # ? ,  !' , & |/ 0@_@Rf<{ 7<{#?@d d  ? ,  ' ,?`&^&L (@#(##\    @f @&' ?L (@#@&' ȁ(X㿐@f1@iB@9 #L`(#@o  @ 4  ) @  4 )& b@%Z@ &@ &`$&`@[L&`,&`(@^!( l@_@_v`,@_ `,@^`,@_`,@_j@㿈@^`,`(@^ǐ@h@8@^ @^[ x ?؀`A ,` @V^ @Z ; 2*@Z ? 2 *@Z # "*@ZȒ / !''''#L`, P@b@ذ.   @d@er@e1@~b. > 㿀 P` 'Y@,!p  ?@@~@7v! L@Z ) L0  , x@ `  @Zk ,`@@@Z e  `P,`@ H:#,J H`@YΒ  #L@~9 , #L "@` `2&@ 2& 2&  2',!p @D ?@    2#L#L `,@ `x &@x &x & "xx 'x?@L@Y~ u#L`!#L , @`X &@X &X & X 'X?@#L 3,`!@ ", ,!h, ", !h, ", !h , ", !h@ #\#`@B@}U '    ( H@]@-#L`,@!x' ?,@X@J?`/l'l@},a@}ܐ@}`l!,&`@Z!@t@&`@} l'l`@X@Xϐ  ,! @Y@YH0 L ,!@~ؒ,!#\    @Z h>m@Y4` Z ! @ H,a@X A,a@X ;@X@Y0  L 0,!@~0+D<      p," 7p p`@s6  p@s" @ k* :  @X  @X@   !," @Zi ?㾐`0`@X0 2O  @Xɐ @XʠcL  ,`" `` @~C  L#, . @~8b` L ,@~/"h`  ```` L  ` *@*L  ,@~ "p 㿐@Y@Rf@] |z2` € @@]   @h$ @{ @{$ @P 㿐@Y@\#L`!,"@,Y @}ɐ @{j  ,,"b@{!`$$ @R4c @R@Rߐ@!㿐`,,"Ȓ!n@}#L`,"@}@g`&`?@ 㿀`@R!@\P,##\   ;  @Yd ? ӐԨ @  @`" "@ `  ?"@: 㿐 3 `0  ,``( _@U@U _  `@yҒ`? 2,`2,@@yŒ`?  _,` _,@ 㿐 ` 0 " @pk*  2` ``2@ 2`-` 8- 0㿐 ` 0 " *  2` ``2@ 2`-` H- @㿐 4`2- `P@T + -`X@T $-@T`` `-" @p *  2` ``2@ 2`-` p- h㿀'H` 'D#L`-@z x H 2 @Wd? @4 [?D @Wv? @4ղ m?D @W ?  @4  cL .!?-? Ɣ?? ?? „    ?@zx#\?$??%'??&'?? ' F? D?' B F B<H   jD6H@rbD#L`QH`  `   cL -@z* #L -@z"!5 !-!p+-cL a@  !p`"!p` "#\ #\#``"#`@yH    㿐g `2N$   L`" @S "  ,@@x,,,`  ,@@w԰&@㿈 '@xk1 @ua&  @u|㿐    @Sk "  @6  ,` , @SW 2   `@  㿈'쀢` @x(@Sƒ / , @S . -@wax ",@@S<bo@S즒  #L`r-@yJ!0m@q c+-)-;-9-7-[5- X @Sa R@S! M@RḀ H@SC;bВx*  7 @v aȒ!@w;!d`` ``Ú`*  !` @R@Rܐ @vh $@aȒ!@w!m@@R@qR0@v0@v@SR 2@SP@v'㿀`'N@ " W  #L`-!@xÒ cL H  ` @`#L -"@x#L -@x"0 33-ap--+-#L  p b  "ap  `"ap`#\`"#\ @x` @` #L*  2    '!- @R ?#L@w0 @xQ"@ve@vb&  2@p㿐  @R       2  㿈 /'@Ru `  -["-X"-U"耤`@2,@@Rq`@ /,@ --#L`Z-!@wV +-)- ` @Q @Qa @Q!  @v@RC 2@@RA쀢`- @Q@Q@u1   ---"a@u!-`#-#-# @Q@u'#L`-#(@w0 㿈'쀤n? "s N g"m @QkJ?`/ c E'C @QՒ . -!x @u 3cL -#@@wk ('cL 9-@w_#`= @Q3cL !-@wM#t  'cL -@wA#  @Q#L`!-@w*# @uڐ㿐  @PĀ@4"ā㿐!@uĐ #@u` @Q /`@Q /`,.@ Ȥ`@v`  @v @   ` @vx`̀@ 㿐 - ` @P@P@tA   `.. `@t Q`@PN@` J?`/.`(@P̐@Pɐ0@P  㿐 ;   @P''@t   2 .`.. 0`@t k.`    [.`"@PsĐ  ` ,Đ  ``   ]*@,㿐 97 @t  .. H`@t x$ @u @u3` @q&``@r##L` . X.  @v2  㿐 @s͒ ! $ .. `@tJ ; "@ @tɐ #L` . .  @v 㿐 @s ! $ .. В`@t  "@ @t Ő#L` . .  @uՒ 㿐 @ss ! $ .. В`@s  "@ @to #L` .!.  @u 㿐 @sF ! $ .. В`@sÔ ̀  "@ @tB k#L` .!@.  @u{ 㿐 ` $ 3 `" `"  @Op /` `  G*  + `  @tޒ      2 2   " 0     J@ @*`   *"㿐@N$@: N@ *@`@**@N@ @*@``&㿐 @r  ..!pa@s x㿐 2 @r  @r$ @r$  @r$ @r$ 㿈@+ ` '@NJ?`/.a@sx'؀ t` ?' '@  a`, 2  @r@`€  "&`@`@Na@N^@q  2 ..!a@r @N^@N n@r|@rz @ a@ro C l @`€ 3  %@o`@N@N@q  2 ..!a@rX @N@N: )@r7@r5  @+  @r* @'$ ?J  ܔ*J@` 'J ܐ > *`  ܒ /*ܠ? 'ܐ*@`€ @` €  '܀` ? ܔ*܀`'?.! ܐ*@`€ `` 'ؠؐ  `` ؐ  ` ` ؐ | ؐ*@@ €@`€ 㿈 u B@   "     " Ӓ ʐ @q@`€  $'.>a.! 8*@`€   '.a' #   .a3    .aȐ   *@@ €@`  ) @`€ 0    Ѐ@  ԁ 㿀 '  @p (  ).`@pi   & !..a!@q!T#.a@l_@Qߐ@Qѐ &@R @Q@lJ@"& & &  & $ А!@k& $& !#\    @N `  `2 `2 @p & .a@pӔ!n@Qn@ . a@Hv @L ; 2 ,@@L ? ",@@qE@)@L / @Ld?@ @  `@q0.@qLa#L`  .`"a@rh@p|@pz *  `  (     V. b €`€` € V` € (`       ". b8€`€` € "@p/'㿐  `D @K@ov  $.."Ha@p)!@K `@p   @p   $    & O" @K $@ Ԁ 4 & $ @j2 㿐@@@K㿐@@@oP 2u "0`@@"H"(@jF   `2@ ے ` @`  "?$ @iܐ )   . b` . bp€ .bx@KZ` € B` €  * €`€ @o] @oZ$ @oW$@oT$      `   㿐cL  .@q"`쀢  @K @   ?   cL .@p" *@     2(,$$@ 6@ ~ *  耦 VcL .@pΐ"ؤ 6-.  @pŒ )*@  !@4@ P  s*       22V쀤 cLk*  cL .`#8@p`@. "a 㿐  @JZ@m   ..#hc@n @J[.c@J{㿐   @Jڠ@nrh h`쀢 d Ґ#L`.#@pF`U.c@J    #L .#@p6@nJ0D,@ "8,+/. # / (  #\ #`N  0#d#h #l $#p (#t ,#xN 0@I#|  #L @p`00   2 2 V@Iɐ@n p 'D @m 4  D/. Xc@n !YD@_@_@_@n @n /`(@I @n|   $ ( ,;`;hD/#p`p#\   @I  #L`F/@o C . ?. @ @@!  @! `"@":`쀢  "W@m-  $`/. c@m!"V`* @ `@k)`"@`@kB   " 㿐B"a     N@ "2&   2.& 0 N@ `$& 2N@N@ ` & @j/ @i K @i& ` `  & & @j `4  㿈/ 㿐@H㿐  @i  @i  㿐 ?#L`/@n @i @m㿐 #L`/@n  @i?@l0?㿐 @lx $ 2 //.!Hc@l"/!$$ @iS"$ $ 㿈 J  쀢`2F- 8/@d^aX@(@H@J /@h!`@M     @M #\     @M@Mo@MG/@g!h@@@  @PG, @< @IB@l@l- > Ȓ',` = @m,,'/`)/*%/.,@HÒ0?!#L  ,@nQx,@H͒!  /#L ,@nE!, #L`,@n< /. @HF / Ԁ`, @lE',㿈 /a@cl  ܰ`X" @G  ܒ@J /J/@la0E/!@H$'쀢  /@H" /@H" /"@c @G'@J //a@lƐ/b@l@G@J //@la/a@c"   "`@k '@k'] ܑ*    #L` /@m"( 㿐`@cc 㿐 Wa S @G@k   /."Pc@k˔"@G/b`@G/bh@G` %/@#L`/"p@m@G\   Ā * :  @G/@k b@G7 2 $#L`/"@ma0@kt  㿐 "# @G3@j   /."Вc@ks"ƒ@G4/b`@GT1! @G&!@G@kK 㿐@8u*  25 ! ܀ 20 * :  2) @eh ܑ*    V#!/"G c@<!H !0c@< 4H c @< * *`  㿐J ـ`!   G@@B@f[. >  㽐 3`1/%)0'0 "@BZ 4 L ! @h&#x  @C  `€ 0 ߐL @h  㿐@F̐ U`S "R ͐ !#L`0#@g @A #L 0#@g1`@A 1#L 1 @gג@t@e& @aB 81@a> P@M{ @";@Cz@K̒ }`€@A@eǐ. >  㿐 `" @Fi  & @ @fI @ݐ& @K.   㿐 " @*  2  M@A@e @A 㿐`쀢 +   *@  ڐ     2 @c@V"@` "` P@D @F@*  ???(* :  s @N  1 ``@AcL 1 h@g1`@D@CV N   P  0a@`. 1@@1`@`$ "1@@1@`` @@@@  ( ,"  @@ #L`1@fҐ   $@ #L`1@f    &     㿐 ` #L`1!@f& 0  㿐  #L`1!0@f& 0     0@ 㿐 "  0 2 #L`1!X@fu& 0  㿐 2  /@\aX㿐ڐ*   * @ 㿐 "   & #L`1!@fE 㿐 "     @@    ,  KN !! `$!@d7 㿐ڒ *   ?㿐#L`1@f !Ȓ ?㿐@@7 ? ?㿐  @@0 ?  @$ 㿈/ 㿐@?ܒ㿐@A@DJ ؀`J ـ` #L`d1@e! @Cѐ J ڀ` #L`S1@e"t @a  #L`D1@e"0e    #L`50@e!@V *  *   #L` 1@ey"`A Ē.`  1".#@?4  #L`/ @e_"% #L` 1`"1"1" @eL  @b $  11.!ؒc@ck(81!&& & & & . 㿐_ 㿐Y 㿐@@ې@9@D> |z2` € @@D(   @O5$ @c @c$ @8 㿐@C@@#L`!1"@{@d @b  1."c@c ($$ @95Mb|@:@:@㿐`.1#(@e #L`1# @d&`?@ 㿈`@9E@Ct  &@2`1#P#\   ;  @@`?2`8#L`1`@d3#1#P#\     1#P#\    @@ ?&@&@`@ ה U<{@@C@B @|@9c@CΒ 1#P#\     @?ݐ @&@*  "i@@@B*  2c@@8*  2`#L`1@cڐ#@8@*S F C #L`1@cɐ#Mb   @N 1&`/#-1#P#\   &@8t@+O<{ #1?!&@#P#\    @? ?&@!0 ̐?h :::7P8@8:t㿐 2  @a @a$ 㿐 &  @a&  &   2 & & 㿐 @a 2  12#`@a f  $ $ & &  & " & & 㿐  (  #L`@!2 @c<  `" & & @` & 22 H`@aU }#L`@2 X@c"  㿐 0 "!  "  `   &   2  , 2  & 0 @㿐 0`2 (X 2  @ 2@`b 㿐  ` €ǐ@`R#L`2@b5 ?㿐 @_Ғ 4  22!`@`P!,! && & & @& & ,#L`@2 @b!(㿐ڒ  @G& ,㿐˒  @G& ,㿐  @G& ,㿐 @㿐 .`:`㿐 €㿐 㿐  @ "N  € N @<' @_  @_& @_&  㿐#L`@ 2@a!P   €N `@< @_  @_& @_& ?㿐 @_  2 222!a@_ m2!l&.:@ɐ& & 㿈.E'쀦`L2!@70  "D@; /   @;-J?`/ `?`N` `2! `@`C !`!!2!2 !Ș! @`/  @+ '쀦@_#L`@ 2`!2!@a 㿈@<@P @,C*   2"#\    @<ٚ @Fᔀ  #L`@2@`"@Fd@ a@?$@ `e@_ i  Ā*  @ Z@ R@^А@^ΐ2b0@:} 2%@:2b#\   5@<@^@FcX #L`@2@`"8@FX,#L`@2@`"h@F>   " 㿈@<*@P@+Ƥ*   2"#\    @<\ 0: #L`@32/"@?.@ @^o2b0@: @:.2b#\   5@<-@^X0 #L`@2"@`9@E! `& @: @: * @` @] & 22"a@^G!  @: 㿐 @E@?& 㿐 .`@:}: ? ?㿐N@ "   @:r? ?㿐@: ? ?㿐  @: ? 㿐  N  @9 0ؐ@]ѐ 㿐#L`@ 2@_"  N  @9~ @]?㿐`  #L`@2@_#8@EZ@]6  222#`cp@] g2# && . 㿐@9 < :2c@]۔  22c@]Ԕ +2c@]͔  $2c@]Ɣ  2c@]  2c@] " N <2 @9N  H2  N  >   㿈N  2g  + P cL @L%2 *` *  @90* '3 $* H* D * B'@9'3 0*` H* D  * B'@9'3 4*` H* D  * B'@8'3"HDB'@^ 0"  8 4 *  $@ @Y < 8* 4` 33@XE @C <@X> @C <E*  3n (3`8@8  33c @`X@9 3``@9  3`h@9 3O p3`@8 3  3`@8  2 33 @W@C0Y4 3`Ȑ@8  3) 3`@8  33 `@8< 33!a@8  33 ! a0@8   33!8@W@B0aH@8v  33 !Pa`@8l  2 33!h@W@C0@W!p@BԐ@B̐3@W!@< @ cL @3@^!݄@B@WcL @"33@^!3@Ww!p@BcL @ 3"@B  @B @]@B   @c   & cL @3@]" @C&   .  㿐N  NJ  "   ";N J & N@` @ $  & $` `  ( & (`  , & , ` 0  & 0& 4  &  & 4 8@*  & 8`P 2N   4  㿈/ 㿐@7L㿐N  2 ! 2  . @ 2@[f 㿐  ` €@[X?㿐 @Zߒ!  333"b@[]!3"P&@8&  <& & & & 8㿐  4  .`:`㿐    €㿐    㿐  4  @㿐 #L`@3 @\ߐ" ?  &  @@Z ?㿐 #L`@3 @\Ð" ?  &   €@Z͐?㿐 @ZT  333#c @ZҔ `3"쀤 &@BR& & `& & #L`@3#0@\ 㿐#L`@3@\#P@Z 㿐#L`@3@\y#p@Z?㿐 N `!&  ` $N @7   @      *   .  . N  2N @; @ ?  @W  . N  " ?@Wp 㿈/ 㿐@6 㿐 / &@@Y   33#c@Z> z!(&& & @&    @V&@& #L`@ 3 #@[ 0@A@ 2㿈 .`>``€ ' € ' €㿈 `€ ' € ' €㿈 ` '  ' €㿈 @ '@ ' €㿈 "   "'@'  "'@' €$ @Y$ 㿐   " ` €  "` €& @Yk& ?㿐 @X   344 ` @Yp 3# &@@& & `2& @@& 2& V!& #L`@4 (@['㿐    @( @% & @    " {2 <{&  㿐`$44 `p ?@[E#L`4 @Zΐ`$@E &`$㿐   V"  @" 2 $#L`@4 @Zג "D $ "@@D& $; @" W  a(@E  & $ @@!hcL @!4 @Z @E*   #L`@4 $@Z!@E $ & $#L`@" 4 $@Z!8 㿐㿐 ";  @4&@ @4   @* & & #L`@4!h@Zo   "@ @XF & 44!``@X   @W  & 44!``@Xz  &  㿐#L`@4@ZB!  " $` € $ @D^& $?㿐    " $  @4B  @ "@ $ @$ $ @   <{ $ - +?)   @4 @@$ &@$ $ @   <{ $ 2 _ @4  @$ 㿈/ 㿐@3㿐   @@W @W&  㿈 O`"N @j 2I @' '?c@4'耢? #L`@4"@Y #L`@4"P@Y 쀦"$ @W% ( 4@V &`44"``@W!4`!Ԕ &`&@&`&`&`&`  㿐  @ & 㿐   "  㿐@-Ԑ@-@3 !4" @5- ;?@.$*     @3 @3 #L`4"4"4" @Y  @ )@ /@-  @ D@- @ _  㿐@-@?  `@%?#L`4"@X֒@38@?` ?㿐@     H @㿐@  "  H "  @ "& H㿐@    H  ` € #2& H?㿈@ @@-`H  )#L`@?4#@X{ذ?/4 @ |@3 /$!  #L @4#8@X`  #L @14 #X #L @14#p@XI #L㐒 @4C ?1#L @4#@X6 @@ #4@XA$ $#L`@4 #@X" `H@ @-*  ` ` $`  `?`' ?  `H` 5<{ 㿐aH㿐 @S 55#ؒc@S ҁ㿐@S  㿐 ` @T 0  2"   㿐  `" @S      2"   㿐 @R͒  656#`@SK .6 @N$ ?$ D$ x$ $ \$ l$ p$ t㿐 @R  66 (`@S1 ?㿐   #Lh6@T @m `)N@   ,` @. e L` 2 e@R  $66 ``@S e,`@ 2@P"@`"N@ #6  @.  #L(*`x%    2 2 @Pt`&  @SR#L( 6` 6   @T㿈6 @*[ L@ @*S u@R@R0h'@S#@R@,'L % ),`@.X"W L` L L"W@Q  $L66 `@Ro L,`@ L@OL"@L%6@.쀢  #L(@T)@R='쀤    2 2 (& (@O#Lh6!H@T 㿐 N @X@)˔ i @@R@Q㿐 "'    `! @Oޒ*   @d " "  "  " @O @$`$ `$ ` @]$    2"   㿐  @ y㿐 #  @ v  0@ m     2  㿐` ` @    2 @O*``  `, @  @O d$`@Qi`$`@O`@O`8@Qb`$`(@Q_$`$@0$`(@QZ㿐  #Lh6@S8!> #Lh 6!@S.  /  *@$0@Q6`` $`@    2 @N`@Q @OF @NȐ "@d$ 㿐!L`+  L*@     @N     2 L@N@VLL@Pް $L㿐!L`(  L*@  @@P`$ $`$` ` @Nz  `  2`VL 㿐 #   @N  `2 @  0  @N  `@ @N  2㿐   #Lh(6@R`!G ɐ  >  :   *`  0     2 # ``d*`  *@`0@Nf @P9 $ @P6 d$  㿐!L`/ $"W@JF) '6aL*@  @Jd*   #L(@Q  `  2`VaL   2"   㿈 ''  "`(  `(@Pv@+`(@+  @O$ '66" `@Oה"[ 6 (b8 @+㿈 ('@    @PH@+m@+j  @N '66" `@O"r6 b8@+p  $ "(㿐 ` #Lh6@Q^"@0@P $㿐 @Oi $& $   @    @ 㿈  ' "  `@O㿐 ``"_ @5  @5q#Lh6"x@Q`K@H  #Lh6"@Q< 2: @5Q#Lh6"@P@5~& \@5& D@5& H@5 & T@ 0 @I@6|& 0 @46 0@Jc 2  @*ې @    8㿐 `"  8 @Lk& 8 8@L* :  㿐  `" @L 8* :   2* ,  * , " J ,㿐 $ `P  `0  `P6@Ic @PG@O-@ " `(@'*  `(@O`P㿐  `" @O P  㿐 "  ``" 0J@   6@Iuc  `@P 6 @N ` 㿐 `"  " (@% & `    L㿐 "  L @H& L L@I* : 㿐 "   L 6@I.c0   D 2" D  H㿐 "  H @H& H H@H۔* : 㿐 "   H 6@Hc8@I; 㿐6#8` `* : 㿐 "   H 6@Hܒc@@I 㿐6#@` `* :   T㿐 `"  T @K8& T T@KS* :  㿐   T  ` @Kt* :  㿐 "   T " @K#& T 㿈 "(  X 2$ X 0 6@H}cH X`'@J& X @)L* `, X@H@K @>  X㿐 `"  X @J& X X@J* :  㿐 "   X " @J& X  ?\ 2" \   \ " \" \  h 2" h㿈 "  @ 2 @ 0 6@H c`' @  @ & @@>  @ 2" @  @ " @㿈 "  <`" 0J@   6@Gؒch'@>a쀢 @MV < < 㿐 `@MH < 쀢 @M    㿐 `@L 㿈 "  `" 0J@   6@Gdcx'@=쀢 @L   㿐 `@LԐ 㿈 "  d`" 0J@   6@G9c'@=쀢 @L d d 㿐  `" @L d  㿐 "? l?2 l 0  6@Gc  @@Ȕ & l l 2" l㿐 "? p?2 p 0  6@Fc  @@ & p p 2" p㿐 "? t?2 t 0  6@Fؒc  @@ & t t 2" t㿐 "? x?2 x 0  6@Fc " x@'o& x x 2" x㿈   |`" 0J@   6@Fc'@=$쀢 @L | |   |㿐  ` | @L |㿐    | 6c@K `?  0 2" 0  㿐  #Lh6@M"#Ȑ . 4 " J 4㿐#Lh6@M# T & @@H& T X " P@H& X P@K? `@K& P <& `@K& \6 @Fg& < H`& D@E & H L " @E& L & x& l& p@J& t @J&  |@J&  0 & |@E& 0㿐   2?@㿐   2?@㿐   2?` €㿐   2?@㿐   2?@㿐   2?`€㿐  2?@㿐  2?@㿐  2?` €㿐  2?.` :`€ 㿐  2?`€㿐  ?`㿐  2?@㿐 9  " @&  "@& ?" @&`@ #L`7 x@K?&  @%cL 7  @K& @I㿐 @%Ӓ C cL  7 @KɒaP   C@Ie  $aP77 `@I aP, @  @GdaP"@aP @@IM ,  777 `@I˔ 77 `H & & && . & $& & @GcL`7!@K㿐#aP ?  C@%xaP* @` 0 `  ``2@ 2 㿐 "P #L`7 $!0@KVc"% $  |z|w2` €  @ |z|w2` €  $@ $ !P`    @% C* @ "  @G @ 㿐aP #  P*@       2 P@F@BP@HP$P 㿐aP !  aP*@` s 㿐  @G` @G$`    2`@Ev  㿐 " @E #L 7"@I @G @G$ 0 㿐 "     #L 7"@I} ,      *  T T   T @ J `@   㿐 "  7 cL  @I>      2 2    & 2   "@  㿐  L K  !X _ @2  K  #  @Fh   77#c@G GK ! !X % _ ` @2 **2 @* ` @* K  *?Є  (??Ʉ?(8㿐  #Lb7@H# $ N " ,@L %  L ؠ * ,@L  Р  @@,@,@ L `,@㿐#L 7#P@H"!㿐#L 7#P@Hq"! @ 㿐! #L 7@HS#p?€㿐! #L 7@H<#p? " "  㿐  @E̒  2 & 77#c@FJ L& & && #L  7#@H0 㿐  @F#L 8 @G   " "   " "  2"   㿐!Ė @  ` `1#P8`@!ǐ     ?㿐#L`@8@G!81 &#d#d 㿐@-_  @@㿐#b@\ `d2h @E; 0 88!8aP@E @A$8@@!`b@$ $ < < (@@< $$ @F3 $ @F/ cL8!p@Gm@C=㿐  @Ev` @Es$`    2`@C㿐\ ` 0d@Dh 88!8aP@Ej @@$@@$ < < ($ $ $ < #L 8!@G(@B㿐㿐 *`( "$@D  88!ВaP@E4!@@z$$ $ < #L 8!@F@BȒ*  : #L  8@F" 㿐  @D    2 @B    8 0 㿐 `N@   #L 8@F"80@DN  2 88"XaP@D̔!8@Bq@@< $㿐  @D    2 @BI㿐 `N@   #L 8@Fp"p0@D  2 88"aP@D!Y@B4@?Ґ< $㿐  @Di    2 @B   㿀)'X" X `@A%" " #\#`#d#hښ $$㿐%$ @A$$$* :  ((㿐%( @A$((ך* :  00 ,,㿐!" "!$" !"0 "!=$"0!"$ "!$"$!"( "!$"(!", b$", *`")   "% ``  J  @*" J    (8*"`J@2(  H8@>"@1Oh#"Y`? #L 8@Ev"@+5ⴀ@#L  8"؀` `@Eb@+!d#L    ` `8`#8#H8#H@ED @"+b '' -8*`@.`" `@:3*  & `@:)*  "@i*  2b@*   `?    2`2@`ő*` P@>k@2 @>f@ #L@8@D#X$@* @0@>MP@ #L@8@Dѐ#X @* @8@DƐ#x@*v@'''X#L  `8# ` @D8@>#P8?#" '' /  "0 8; # " ?@9*  b8 DBX(D F€    22  ͑/ 8#H1Oh#"Y` ?#L 8@DN#𐕠@* @!;b$''L@ 9 @D7  *`@`" `@9-*   ` ?    2`2@`*`%#L@ 9 0 @D/  "  <6 3- *9@=Z P%9@=U X 9@=P h9@=K p/   #L@9@C̐ x @9@CĐ @)t㿐     2  K @)\@ @)g㿐 @@  ?@@Q. @)? 0@)KP#L 8@Cr# z@)1v@ lb(''cL! 9@C[ / :  +9*`"`"#L@8M*  #L @CC`Ѐ "``       2`2@`ё*`+9@< P&9@< X!9@< h9@< p@.`  #L@9@C x0 @9@B @(㿐     2  a @(@ @(㿐 @?A ?@?D @(v 0@(P#L 9@B 萖 y@(hu@b(''cL! 9@B!/ :  +9*`` #L @Ba( "``       2`2@`֑*`/9@;͐ P*9@;Ȑ X%9@;Ð h 9@; p@.`  #L@9@B=!@@!N 0 @9@B2!p@'㿐 ,@@=  @@:&  @@7&  @@4&  $@@1&  \ & $ & \  , @   ,  L @,/@= 4@= 8@@㿐#L 9!@A@=  4   `?㿐 "N @>H 4@>E 8cL#  !9!@Aǐ %9@= 8 L@A \$ P @ < @@"& @ꀥ $ )%9@> 4 L(@A \$ P @ < 㿐`\̠@ @+&`L㾈w@#%)9'9`\cLȀ9"`9"9"`\@A\ @=`4 cL @@ @AH"`\ < @ f 2 ```cL"&`@A4&``  2 #L 9`#0@A" @i!0@9`#`@A @[!Q`\@ cL@E ` ``F`4    2`#L  !9#@@q@@#`\`@`<7#L 2 @=?`4@=<`89`#`: P`?`0#\ @@  @Ԓ  #L  :`@@ X 㿐  #L :@@ ϰ M  # , @ C L`bP bP C@>  $bP:: `@>!#bP,@ bP@<bP"@bP.2`3)+#-:@-    @*   @W bD @ #L@@BD     2 2  :  \ - ( e@0 @c*   (#L : \@@ @P 0J"H & (#L B: \@@! 0=#L 9:!H@?04@=  ::!`@>!P&@> 6 @ bd & & & H)'p% `H ,   &@ #L@:!@?Ȗ@;㿈@  :a@   @Ò @   :L :!#\   4 @ @=8 @ : 3*J` "a @`cL@q 3cL .:!@?}6 6 ڐ 2 & hcL :@?q"?& d   h "`"`"` 6 h2`@=z㿐L@  :"@`: P@?Q `JbP F L@  *   @= C L`P*@ 1 /%+:):@  @0 D @  Lb`@? "@?0    2 2  㿐bP   P*@  0@;? @:BP@<P$P    㿐 `@=    2"   H H# L L 2" ( ?( 2" , ?, 2" 0 ?0   2"    "   㿐  `" @=     㿐  `" @=      $㿐  `" @< $  㿐   :@   \S  \@N` \I& & (& \& d& 0ǐ*  ". X@ . D. X. Y& H3cL!:#8@= 8`" `  cL!:#h@9 @=@  " J P㿐 "I @9 4 C T & TcL# : #@=_ \  \@` 8& `& H@9& 8 %:+@9 4#L@=? \$ P @ <b 8@9)& @ \’ m? @  $ l \  $ $ @@k/  2`@"?  #L !<!Ȓ@9 ? @ ?@! { @5 4 $ @$ @<{<{?㿐 0`.2`P`\  `\@`!$`?#    &`P` @  6*  @ $`@ $ `\  㿐 )`'?`P# !  &`P @ @  !@   & I*   2  l \ƒ  㿐 2&  !#L <"@9N Y  `  #L <@9"8  ?  h  " " |  "  | " " x  2 x " x  "  x " " \ 㿐  @5& 4    4   2㿐  \ `" `Hb #L  <@8"` 㿐  \  `" ` 30 #L  <@8w" 㿐 "   \ ` " 㿐  \@Ք  <{ 2#@㿐 "  \    #L <"@82`€* :  ? 2"     ࠀ 㿐"bd#L <"@8 d㿐 4    2`?#L " \!<# @ |@n@7ސ \ & `@`<&  2"   `㿐"b`#L <#H@7  h h㿐#L <#x@7""X㿐!"X  #L <@7#?@ !"X@(\ (\㿈@'@6,㿐%L#" L!<#@7^@5r  Є  ?*H #(?Є Ѐ  ?#@ 㿐 h = ` @"㿐N@"a h J` `:" * @ 2`."J @ $@ : 2*@. #L  #=`(@6Ȓ ',/ @!  @ .#L = X@6Ւ,@5   ``@h! `@Ғ .#L = x@6,@5l   `H`== @t` @`/30`@5   =`Ȑ@4  &O66N "  " N`"a @`2 *J "* "*N 2!, O@< =@@`1,@! #L =@6Y =a@5 ,C =`@5&@5# ,@'@q  @N . "@5,, ##L*`@: , L  @,,J?`.cL@ ,@*cL@,=@6!,㿈@  #L  =@6!(  @@ 2  =@!P  #L  =@5!X  =@!x  #L  =@5֐!  =! '@4=a@4 @4@3Ӑ =@ʐ! 3l==!@w` */p O@r  OpN "  " N`"a @`2 *J "* "*@X =N 2=!@4+'ll*`@đ: . N l㿈"l?'@h '@h!`  !!$blbl $bl#L  .!=!@F @5<bl㿐@ P@ #*& .  @-. p =0㿐 !@3͐"p"pJ  "a _*`:  `2*J    t =8㿐 !@3"t"tJ  "a _*`:  `2*J    x =0| =8   H(H㿐#L =@4"@@X =@"x= @#"@#"b *b㿐#L =@4"@n!#w @2"pbt@2$"p@.$bt@+]ა @X@#b@#**b㿐 @2  =="Вb@2 "㿐@2s 㿐 B`@#Lh="=#0=@#0@4= & & & $ $  $@/&  @/` `2`@/`"``@/ 0 #Lh =@4#8 㿐 /`-#Lh=#X@32 ?& && &  @/ @2  "` ``2@ 2 㿐 # #Lh=#@3˒ ?& && `&  @1    2 @/x &  㿐 `. #Lh=#@3? &@ &` &``&` $ $$ `$  @1    2 @/D`  &`$  `"  2 0 "     22 㿐   pߚ  ` 0 `  ``2@ 2   2"     2"      2"    ?  2"     㿐 H""@18 2 @ @11 2 9 @1* 2 2 @1# 2 + @1 2 $ @1 2  @1 2  @@1 2  @1 2 $!@0 "  1  + & !  @ ! "`  `  ?8㿐 :`8 @0   >> 8`P@0 p$ @1 $ $ #L  > X>   @2?@.*    @/ cX* @  㿐#L > @2# `` `@.@0* @0'$   ``2@ 2 㿐#L  >@1  @0 `@0$`    2`@-  㿐@h   1 `.`-/-+> "L@1W L` @1  = 2    2 2 @/㿐 <`: @/8   >>!`P@/ Հ$ @0<$ $ $ #L >!(>   @1m@-=*    @.Nch* @  㿐#L >!p@1Q `` `@-J@/X @/U$   ``2@ 2 㿐#L >!@1) ` `@-$@/2 @//$   ``2@ 2   㿐#L  >@1!  @/`@/ $`    2`@,  㿐N @j  @  :`7`67/'-> #   "L@0Q L @0  4 2    2 2 @.  㿐!" @,8$""* : 㿐bI* : 㿈/@ǒ "O 2 O  b|  㿐!" @+$""* : 㿐bޒ* : 㿐b* : 㿈/@֒ = 2 O  b0   㿐bĖ "b#L "Ȓ >@/" 㿐"Đ? #"#"#L >"Đ"h@/ȁ"bĐ, 㿐bȖ "b#L "Ĕ >@/Đ"㿐Ȑ? ""#L ">@/"", Ѐ  Ѐ  Н㿐`"?`@ `>> P@!@/ɖ#L >#`@/v@-I㿐 @-  >>#`P@-"$$ c   @ $  㿐 @, T  #>>#`P@-r"#bԒ"W@ @b̠ & $bԐ"W@,ے  $>>#Ȓ`P@-Y"#̑* `2 @*̓*`" ̕*@* В`"#L >#@/ 㿐   #L ? @.@  T& 㿐 "  <"   #L ?  @ @.ٖ@R @ < 0 㿐 "  < "   #L ? `@.@3 @ < 0 㿐Z " @ . 0@ <@& @ I㿐@ ` \% #*   @ ߐ*   V  ?ܩ#L "?@.k @,y?`@6 @]  #L ? @.O@ #L ? @.@@,T @,QE @,M@z@& #L !?!(@r@.$.  ") @*   @ l*  " @ , 0@X$ $ $ @ cL?!`@-? 㿐@  `~ |*   @ 8*  o  ` #L "?@-Đ WL@+Ґ@  "?`@ @  #L ? @-@i #L ?!@-@+ @+K @+@ϐ@{ #L !?!(@ǐ@-y4 # "/ @K*   @ *  " @,`0@$`$` @ $`@ cL !?!@ r@-I? 㿐#L  ?@-9" 2  T 㿐#L ?"H@-& 2  @˒ @+3 㿐 "̀`" * @ "  @)ǐbа ?"bа  2   " (" H" " " $ \ 㿐%L!?"h@, "4   (   @|x2 ֐L@!?"@@,ǖ G *  G  㿐 " *   v* @ 㿐#L ?@,"b̀ )  ̑*@  CT     2 @(9@V@* $""а 㿐 "     6* : 㿐 /Ӑ @  @ ?   #L ?#@,@ <  @ @  < 0*   * @  #L  ?@,#8 㿐1#L!?@,#Xb̀   b̑*@      `2@ Vb  #L ?@+#  ?4 2" 4  㿐   * @ 㿐 #.`:  힒#L ?`#?#?#.  ?#?#@+ . >   2" L    L㿐       \ հ 0 㿐 " ?   ? \  `" "     㿐  `"  * :  㿐  y  `" "      `"    `  "  ` `" "      `" "      " J 0㿐   " \ "  "  0 #L  @@*ݐ    4㿐  Ր 4* :   @㿐  ⇐ 4* :  <㿐  ⼐ 4* :  4 "  H 2" H   2*     J @ 㿐&@&`&`&` &`@ # *&`@ 2*N -"a!@J `  * *` J / # ? : *&@@( 0 &@J 2 N / N  /  &`.`@H /  *&`&` &` 'd'l 'h `@ 8@@@' 2 @@ @`P@(7 @(l@(hl}hzp,`"p ` @@``@ p` @ 't'x'|' t  @`h@`"t@ܐ  t` @ 'x'|':d  @`p@(x @`p@x@`! ?@ 2J@@v?J@ /2*` `|`"@@``p@`/  '   "@`x@y ` @`8@m0 @`x@g`"@a@'bhl@'_'h'l@'@'Yd㿐 L /2@A / @ @@8 @ *@0 : @8  `@jL,  `@J@ .` ? **  `2 `iL`  /@`` * *`V`@   @L` 8 `L` 02@L` /. ,@`@  @L` 7 L` 0 L` / `@  L` 2L` 1L` / ? * *`  @F&  @i @ @&% " J(8:/   ?# J  㿐  #Lb"@@(V cL" @ @(L @ @`Ф  : @L* `,@Ѐ 2  @@`ؤ L /@L /``@D  @ @ " L*`@\: , L  #L@  ; @ ?  @ # @ɐsL /2a  `.*`L  / 2*` /    * *`F*`:  .,*`L  .(*`L  / "*`@@(aL@ /@a@ה  %`L  /   * *`:  /2   * *`L  / *L L * *`L /#LL . #LL .#LL 逢 /#L""@@'[ 㿈N'   'N@`J : `" `/2   J K"J`@%HL4K@%ސBL "` K  # ; ?`/,`@@$z  '@@!`P@%-!쀤`*@@ a`!@@! @J L@ @aL"@!(@&ݔ㿐 (N $@%@ `` ` `$ !#L"`@&.#L"@&  N  㿐 E  `"A @$F   @@!a@$Ĕ 3@%M@`)' @L* `,@%>``@N@* `.@,` "4`$` $`@")%"L@@!@&l"@"<* :  㿐"؀ "# @)  @"X@$e@`@$b$@@$_$`.  >     2`2@      "   " J 㿐"؀  @$, @$)&@$&&     2 b@!ɰ $bذ 㿈`&"؀  0@Ē      2 2` @@a#\  @ J 㿐 `" @$   @N* `.      㿐 @#Q! @@!b@#Д @& & @@"& @@" ?a#   & & 8& @& <& & (. 1& D#L @"0@%㿐 "  & & & & . @&  㿐  @"ؐ!  @@"Pb@# @{!cL@"`@%R㿐  @"!  @@"Pb@#l !@\㿐 #L!@@"@%,  "   Ѐ cL@@%" @ @J& &  cL@@@% " @ @7& &  " 5 " x x @#  & @ " @ " @ " @ @@"  & @ " @z " @t  @@"ɐ㿐 " U * :  2*   " J 2*    " J  ? 2"    2"    2"    ? 2"      2"     㿐 "    2 @n&  㿐 "    "& @&     2" 㿐X  㿈 "  .@&  .\:#\К* : 㿐 "  .@&  .:* :   ܐ ܄  $   $" $@   ,   ," ,@     $&  2* 0 " J 0 2* 1 " J 1 2" 4  4 2" 8  8 " 8  8 2" @  @ " @  @ 2" <  < " <  < 2" D  D " D  D * "  2  *@  * L" H `" H L*@ H  * T" P  P * \" X  X * d" `  ` * l" h  h * t" p  p 2*  " J 㿐  `" @!     㿐 2  @ ΰ $  2"   㿐 "  @T&  @* : 㿐 "   " @F&    㿐 "   " @2&  㿐 "   @&  @f* :   㿐 "  @&  @M* : 㿐 "   " @&    㿐 "  @&  @&* : 㿐 "   " @&    㿐 "   " @&  㿐 "  @&  @ǔ* :   㿐  `"   @" @      㿐 2  @ڰ $ 㿐 `"  @i&  @* :    㿐 "   " @S&  㿐 "  @@&  @`* :   㿐 "   " @,&  㿐 "  @&  @9* :   㿐 "   " @&  㿐  e&  & ā    ā 2" ȁ  ȁ㿐 `"& @7& & ́  ́ 2" ԁ  ԁ㿐`"& @& & ܁  ܁ 2"    2"   㿐 `. | x @& x xc* :   㿐   x  * :  㿐 "   x " . |& x  2 | *@ x㿐 \`.  @D&  * :   㿐    * :  㿐    5* :  㿐 "   " N. &   2  *@  2"    2"    2* ؁ " J ؁  ?   "  ? ? $ `( "@$"@? ?    ?   $㿐  ` " (o@   ?( 2"      "  @  2"    2"!    "㿐 +`"* & &`! 2! &! &! 2!@F&!!@a* :  2 ! `&! #L @#@|  㿐 B  >!2 !! & ?$! $!   `@e*  `!  ?$! `"! N #L @#(@D! #L @@9#XL 㿐     @#L  @@#x "  4ɒ  㿐 "@  耢"<  75  v  ̀ `@`2$  $ %L#@#@!!   $!L @@ِ#Ѐ   O 4և   㿐 '  #"" ! `$  耢  @ `!$!#L @#@  㿐 "!  " ! "!!      2   㿐 "2  `-#L A@l ("a`$`a "a      2 a     㿐  ?C㿐  ` .`#L A@* @' : `2 ː   ` & 2   " N&   @]& @ * : 㿐  ` .`#L A@ ` : `2 ̒ `2   " &   @)& =* : 㿐 @r \ 2 AAA `@ A@5 ?& @& & <& (#L A @㿐 e#L A @@  @&   & @T  " @N  " $@H $ " @B " 0@< 0 " 4@6 4 " L@0 L " T@6 T " 8@$ 8 "N ,@N ,  D " H@ H " X@ X @@c    㿐   " \&    ? 2"   㿐 "   @&  @* : 㿐 "    " @&    㿐  `" @     㿐  `" @     㿐 "   @&  @ʔ* : 㿐 "    " @r&    㿐 "   @Y&  @y* : 㿐 "    " @K&    㿐 "  @2&  @R* : 㿐 "   " @$&    㿐 "  $ @ & $ $@+* : 㿐 "   $ " @& $   $㿐 "   0 " @& 0   0㿐 "  0 @& 0 0@* : 㿐 "  ( "  0 A@6` 2 A 0@/a " (J "  ( 2" (   2* ,  㿐 "? 0  A@ a ?@?㿐    0 A@a@  㿐 "   0 A@a 㿈 "  X  A@ْa('@ b 㿐 "   4 " @O& 4 㿐 "  4 @<& 4 4@\* :   4 ?< 2" <   < " <" <  @ 2" @  D㿐 "  D @& D D@E* : 㿐 "   D A@ea0@ 㿐A!0` `* : 㿐 `"  H @& H H@* :    H㿐 `"  L @& L L@ƒ* :    L  P 2" P  㿐 "  8 @& 8 8@͔* : 㿐 "   8 " @u& 8   8㿐 "  T @\& T T@|* : 㿐 "   T " @N& T   T㿐 "  X @5& X X@U* : 㿐 "   X " @'& X   X   X" D" X     ?A8"#x#x???? ?Ad"#|#|㿈  @ ?  !A! ) ^?cL  A!@'  @ј  cL  A!@  A@!cL @ `@ cL A"(A"HA"P@     A@ݐ"X     : 8 `?㿈XN 0ܐ-`d  8`d* @€ /#%L A@"x $`dL A"@#2`d#ۿ   $`dcL A"@0 `\?$`dcL A"@{ژM #L`A#@h@FAc8#\   3E?$`dL A'#H|   a $`dcL A#p ??~$`d_ $`î   ?   $`dcL dA#]`\`h@ה  \?!!k ` `#L`A#@@|<{ ` ?$`dcL :AĐ"  $`dcL 0A#p #?!`o"  $`2:`!0@$`"`@$```א`@"?$`dcL A#H$`dcL A"@_Ԑ  t`" ``$`߰`@ ߯ $`d#L`A#@x   #2 `\#L`A@"xi# 0eߎ $`d#L`B @nXB: 8r   ?   a @`h *!k` B#L`!B XJ@̐F '<{ x Ö cL B @?#L`B @@@@蝐&@@  㿐^0N 0ش-`d  8`d* @€ #%L B@|  $`dL A"@s#2`dʰ#ٗ   $`dcL B @`0 `\?$`dcL A"@Sp ?G?Ɛ   ?   $`dcL Bv!#L` !B!(륐@'렐`h@   L !B@!H? !B!h닐@  y$`d냐@В ??o$`dm$`d ݭ  $`d#L`B!@G  i#2 `\#L`rB@ސ 8#H 04`\?"`\@4*   ؟  $`d#L`/A#p@+`d!B x  ǒ $`d#L`B @?mmmLk kmllxmmm㿐 ??#L`!B!@@搠?۝  #L` B@q!Ȁ  ?㿐" $#` @    2b"@n* "    2   㿐   2L ?     @| @D#L` B!@  @㿐#L B"@   "" 㿐#L B"@@  ""        " J 㿈b@w@*   #L` B"x@Œ #L` B"@"耢`@@ɐ 㿀}/  &9"  @S'" *"@=츒  BB"Ȕ@ג t @cL ? B, `"B#@B#P @u. @   "BB#`b@ "'cL  B/``#pB#B#ؑ,  B#@B#P #\@H'    2  *'쀦2 . #L B@/#. . & & & @&䀢`" @ ݐ㿐 " N       Y@ 㿐"  #`@@     2 b@ $ 㿈"' @㿐  ߠ  `?㿐!"ߖ " ` ``2@   8q "" "    2 "% "%㿐 7 "3@2   CC `(@ #@9@'% @L* `,$`$` $` @#$L@C 8@f@6*  : #L  C@W X 㿐"쀢 "  @  @I@V@@S$@.  >     2`2@ 㿐"쀢  @8@5$    2 b@ذ $b 㿈`&"쀤  0@Ӓ      2 2` @АC`x#\  ϖ J    2"   㿐  @s  `CC `@ E`@x & @0 㿐 `"  `"  ` " @ @@@ @&@0 㿐 "$   `" #%'C@]  cL@     2 2 㿐 ` @   CC В`@ z@ @00 㿐 `"   @V@@c @`&@0 㿐 "$  `" #%'C@ɒ  cL@-     2 2 㿐 " ϒ "      #L  C@! 㿐 #```$ "  `  #L  C@ڐ!( 㿐9  2 `"  " &`` "&`&`  #L  C@! 㿐  `_`2?  㿐 3   0/  `  2`@>    0  `  2`@* @x  @u$@r$ 㿐 &`2 @#L dC@K!Xa    % ,` @< e  ` ,` e@֒  $CC!x`@T!,,` 2&@ &"@)#%%'C@ !  @    @ " @ cL@@ h     2 2 㿈 D`B'찒 0 @{   CC!`@!W@@ &  P& @ u@ s& & @Ɛ & & @ cLC!@0#L C!@0 #L  C@!X 㿈 `'2#L C "C"0C"8 @x0 #L  C@n"@ 㿈 ` '찒 @ `ɐcLC"`@O  㿐b %  *@       2 @ @d@9 $ 㿐   @   CC"b@9 -#L C"@@& 㿐 %#L C"@ & 6& ۆ& & Cb@@  @J /C@b  㿐 2 @  @$ @$  @$  @$ @$   㿐  `" @d     㿐  `" @P     㿐  `" @<     㿐 ` @(@O  @J /C@=b     2"      2"    ` #} J@ @a(8 2 `,;=2J@`J@ @J@䀠"<`JT"RJ@\2`J`2``J@F"\C(`J:>8J@\2`J`2``J@,>\)J@\2`J`2``J@)\`a "J@`J@" J@ ,;=J@"#*@`# `"1 J@a `J@"J@2`J@" a  `J@" ""`J@""*@`" @2 Hi "@f H,";"H񀠠"<JJ"HH\2H2H<"\9(J0>.H\2H2H">\H\2H2H)\H,;2H""@("@ @2 Hb "@_ H;"H"<JH"FH\2H2H:"\7(J.>,H\2H2H >\H\2H2H)\H;2H""@("@ `"S J@aJ@ a 2`,"`J@ ": J@"&<(J@\2`J`2``J@>\`J@\2`J`2``J@)\ؒ`J@,2`J@""*@`" ` # J@ @a(8 2 `,;=/2J@`J@ @J@†"<`JV"TJ@\2`J`2``J@H"\E(`J<>:J@\2`J`2``J@.>\+J@\2`J`2``J@)\`a "J@`J@" J@ ,;=/J@"#*@`#㿈 '쀢 J`"a @` 'J " J``{&3 1  'X얒  J`"a @` 'J " &@'J` `{" `}"? 2 * 㿐@u  @0 L  #L C@ Q#X1C#C#@c C#@7,`O㿐Lba    L `" L  "&@ . @  @    $.  @   ,@ b'`'J``  # 'J @ - )cL!C@ #@ 4 cLC@ #a  @7''`' @+ 'p!D@ ǐ @ 4 cLC@ #:  @'x'@ 8'KNba @毒 T TL@ D@  8N  ' 'J @f  cL@pD@ { ` @Д 8'Ē`' @ǔ '`' @濔 '`' @淔 '`'  @毒' '@槔 {'.  @N @*'@%'#L ,`  #D`@@ )D @ "L@ D@ !N  ' 'J cL!D@ !@@ 4 cLC@ #v '@H '@C '`' @; '`' @3 '@. 8' ;   ;cL       Ā E x?cL@#\D!hĔ@   '@r`'8/@'cL@ #Da@Z@ 㿐.`` @!D#@K ( #@J!D#@A (#Ё㿐!D"0@m@4 㿈' DbhBDbp FG*#Db@@9@ 0>DbxBDb9 FDbBDb@Db  DbBDbH9 FDbBDbPB'@0  DDbBDbX?@0 bBDb`B'@㿐 A `"?  ";Db@Ð 2 @ * "-``(@ / #@ / ",@L? * ,L  * @ ` "  L  *  /@   /  /,@,㿐 `   L@ Db@p Db@j L Db@ѐ `@Y #L D@ ~"@@@  @䃒 ; 2*@} ? 2*cLD"@ ^@r@p0 㿈`'J@  D# "N "*  @ K'@O㿐 @F & @> "@:  @7& @4& 㿐#L`D# @ @ِ  ,,㿐`@  `+@ ` @  D @,  & ` @@   DD#HcX@ e@@ `& @  ` @͒ ," @@`@ & & @_  & DD#HcX@ݔ q` & cL D#`@ @w㿈 >  @6C ' %D@ D'쀦c腠&'HDcBDcE HB : :D$c%F:L  @ @ i  `@Ϡ   #L`D#@ Z  㿐  c(  , N  *   @@ C L`(*@     2`"  @@  (  㿐c(  &  (*@       2 (@@(B"@(@  $(㿀? '쀦`  #L`E@ ?N@ ` % ,` @Β C L`( ( C@h  $(ED (cX@ (,`@ (@g("@(+')E@y  @⭐ c,`@ L @ 8{     2`2@`,`  ' E h`, @&'9 ` "#w?`  &`u& ``* `@}'ې   ?  @.  !E X F  ?; & `@W H ''@   @   2 #L`E@ p  @ΐcL E@ 㿐 .`:`㿐 €㿐 㿐 @ ?㿐  @   EEE a@ FE && 㿐 @ 㿐 @d  2 & EE!a(@ & 㿐 2  @° $ $ $㿐 2  @ @$ 㿐 "9  @&- "   @g*` $ EE!8a(@ @   *  *@Ð @  $ EE!8a(@ D   $  *   "@ $㿐    @: 0 㿐@㿐  `@W @T$@Q$ ` ``2@ @* :  㿐 ` @Œ   EE!HaX@C 8@̐@ǐ @*  : #L` E@!h 㿐 )`'@א@U  @`@     2`2@* :  㿐 `" @੐ @'        2 2 㿐  `@@  @@     2`2@㿐 !L L#0 % @͔)\ ,#0  @ ,`@@@q"W  `,`    @6 "% 2 @ː  EE!a@ B@2@  $ EE!a@r D @3@$"@㿐 !L L#0 % @{)\ ,#0  @{ ,`@@@"W  `,`    @U "% 2 @y  EE!a@- r@@m  $ EE!a@  t @@$"@㿐# *`  ``@@@$` 2`bV*`*#0㿐 2`0#@c4!@{#8c4@ђ / $#8@̒ / E.@.!#8@߄ ` #8@}c4 2 @w @r    㿐@JJ#0`# *` ` *  @Q 2 bV*`㿐 @  2 & EE!a@ $& 㿐   & @ߤ 㿐 @f @c&    ?㿐 `& @6  & "@x   㿐 @&  & &㿐  @( 㿐 :   ?@+   @ے & EE!ؒa@ |    @9    @ & EE!ؒa@    &  *@ &㿐@ޯ@㿐 ;`97  &+  @޶ $  & @ & EE!a@є    "@ @@  & EE!a@  @ެ&㿐x 㿐 2`0 @ * @s &@  & @K & EE!a@     @ި" 0 @  & EE!a@{ 㿐 @  2 $EE"b@l $$ 㿐  @M    㿐  @͒  2  EE"(b@K . $$ &   #L E"@@ 㿐     2 Ր* :  㿐 "    2  @"   㿐 `  @&`0 㿐    2  @&   2 㿐     @"0 㿐  `   `` 2 @"@  "   "   2         "?     2  ?   ?  " ? "  ?22"0    2򀠀 2" `  "   "  `"   `   "   "  `"    㿐 -  (`&@@ & `$ $`& @@ &@2`$$`$ 2   #L  E@ߐ"x 㿐#LaE"@Ӓ!#<  $#< #<* :  㿐#LaE"@#<  " * :  㿐#LaE@"1#<  \&#< 㿐"#D@z "+#<`#  "@@N@``㿐  `"/ N@ 2'N) *`@۷: N@@۳ 2``L`L@  @ۣ @۠L@"L@ N  㿐 `Z&`&@  &FF `0\ ^@㿐`"4N@ "0 @@@` &FF @`07 l@@q  &FF @`0$ p@L'H'L'P'T'X   @Ő` @ `&`"C` &FF H`0 H` @ڲ@ڡ``L'L'P'T'X'H   @ڋ` "4 @}w` &FF X`0  &FF X`0 H` @h@W``JJ`" JJ@" J  *J@ *  㿐 L@`N  `@ڌ @ډN"`L@``*N `*2  )J`J@2`@ aJ@ " J*@@*JJ@ Ja  J 2  PP㿐#P'H'L'P'T'XH@* 0   XX㿐#X'P'T'X P  TT㿐#T'H'L'P'T'XH@ 0  㿐F h'P'T'X`PF p @ړ @ $ ` `0 @@ *  (2 0 @*  (<2  @* ? @ * `@` =@"  =**" *㿐c #aX"c @ *? 6*!Xc` J@ *?$J@ NN "  " !XK `? # ? :`*` .@= `"!XKK `  *`2 @.@K `K   2 *`@.@K `K   *` .@``aXK? @?(??H;j&. cv" "" " " " 㿐 . 2  ?&   &  6 @"@   & @~@5  ?@1 @ ? @  &@j@P @4``2  ?7 x 8" c @   @V XH    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  (@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @Ĕ/@@ "*@@ 7`/`  @Ȕ)@* @ "@ 7 /  ̔(@?Q@ !@ 1 )  Д/@ `&@  ؐ@@ 0`(` @Ԕ/@"=@ #@@ 7`/`  @ؔ)@?֒@ #@ 7 /  ܔ(@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @> @  `*@ 0* @*  @* `      +` *`  (*  ! `   @* * @ * **㿐 "  2  @㿐 @(  "  "  @<{ <{#L@ F x/㿐#L@ F @  " ` € 0  ` €?㿐   @< #L@ " ? !F@  @;ސ?&  㿈/ޔ 㿐@ԯՒ㿐  "   @    2 .@$ `@  P $D , $   ??????Ц7 @ܔ   @`@     㿐 $   € 㿐   㿐N@ & J?`;  0 㿐  4  FFF ah F &&  & & &   @ & <#L@ F!#耣` @  㿐  4 2 FFF a' F &@& & & & @G & ߯@  l@b @c @c#L@ Fѐ!㿐 2  & & $& (& ,@ @ @ 㿐 2  & 0@Ӓ 㿐@ӕ! d  & @Ԑ && & (& ,& 0& 4& 8& <& @& D& H& & & & & & & & & & & .!H.!I.!J.!K.!L.!M.!N.!O& & & & Ȑ &!@& &!8&!<@c!&!D@`$& !P&!|&!x&!& & & @!& @!d`@q& & @ ' 耢 !D    ` d d@< & $ P L@G 㿐   ( , 0 4 8 D H 2& ( & ,& 0& 4& 8& D& H&& & @  耢 @ { @ "& 㿐 !8&!8&!<!8 @&!8@!8 2!8!< @ ͐!P@ ː!d@ ΐ @!D@!x@ @ @  `@ @Ր"  "" "㿐` @ ! 2&!4 &!4 !4" ," (" 0" 4" 8" <" @" D" " H㿈d` $`` ` Z$`&`` `@U`$`$`Ȑ@$`` B$``@`$`쀢 $`` =$``LaH 0`ȟ찦"3 ```" `.@P$` @J$`  $`$`$` $`@o``@$`$`   @2@d@㿐  @ $ $ $ $       $    L!H 0 ȟ    $ ā㿐  " @$5   " @ " @ @    "@ & "& "$, &, @ 2  &  @`&  @" @  &  " @& &   ?" 㿐 !H L 0  & !H 㿐 !H L 0  & !L㿐 8  L @ 2 ā? * 㿐 L@ 㿐@ʐ  #4& @㿈 L 쀢?"  ? #"2 &&  "& &    #& @㿈 L 쀢?" ?@  22 &&  "& &  `̖ & &  L@ 㿐 L@ 0@E'P LP &  Ĩ/P `|%*`@€`P 0 %  /  ` 8 P@ e`2  h `P`$b  ̀^ \  X$`PS `PN @P@ ," * `/ 0 @!P @ " 0 @  !(  &!$!, 2% !0 " 8 L  "  "  " D 8 P %,   ̘ ` ,  ِ , @ } ,   D!4@ 2!` &!\ ( 2 !<P@ 2ڰ!< &!<@-  "ΰ @( $  $ P@!8  $&!8$ `$   " @ *` @  $ $   @5  $   ( `?& ̤  "@ *`@ $ @`$ $  ` '    ' $ 8?@2 *@ @P 2j   (!D@ !P] 8>$  (  P@j 2S ( 2@ , "v 8@!PP€@  ": !\ (`&!`P@D 2- ( !D ,   ( " ,$ ,€ @ FI  ̀2@ P*`!8 !<&!8$&!< @2 $ @^ " $  ,?&  `"€  ̠!P@  "߰  ,€ @    8 P@Ȓ ̀ @'ŰP(€ 6 0    @EԒ 0  0  /  0     8 P@@} 2'P"&  `P z'@ 0" 8ND P '8 $P@  0"  ` '  ` P@M`2 $ K$ 0"' 8ND 2PP '8 $@P %  0" P@2$&'P "  8 P@P@В    8 P@'Pq$ t8$ 8,XLp ̝㿐    @ @ 2!@`$!D!@$ !D*@,&!@ &!D `$ o!D  !D@`€!D@@  " J    L@2 !D& { *!D$J `3H  !P  @ K  * *  J   @7 !`!\"`&!`!`&!\"@ !P "`!\&!` `.   J`` " *#`#   .$@ .@* 㿐 L'HH@H`"& x L@'&   Ĥ&+` 耢`,j$*`ap@€ 0     8 @ג V& 01  / H 0"' 8N`D 2 '`8 $@ $  0" 耢@2$'' "   8 @ $     ' @'$0P0 PPPPPDPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPĝ㿐  P@A| L 2 @^ pL?'#\#`#d''@B쀢 `A 28 "$08 L@ / 䀢 L@ @@  "$$L PL €@”   @ ` $\$ P H 7?"? 6" ' H'' @CL@1  & ` @ @C  & L& &  ` @ 㿐[   & @㿈 L 4$ ` &`` *` € $     L `@@$ @  L@ `1 *` € y  q$! L 4 쀢 |  Ѐ d! L`@@ @ " "o @V !$" T$!(!"Ѐ`$ $!, Z L!@ < @  6$ "!$!(1$!$ L@u '$ ',  $, !,     @6L   L`@@ # L @Ě! "!(!$!,`$!(  @L  @ 0  Ѐ ! L`@@ @"  Ѐ " !4!$"$!( Ѐ ! L@ К "!$ <$!($ $    8 L ,쀢 " L$ А!@j "ϰ !,  @ $ 2!(!$$!(!($ $!$ @$ ؀ $  L!P@H $ !\$!` L 4 쀢   Ԁ !P L`@@ @/" " @{!\$ z$!` Ԁ !P @  L`@@ @" g @$  $  !4@ @z^ 8 ؀   @`  $  $ !4@ @g!PK 8` $ `X V T  !| *!x @}$!|$!x @y$!|$!x!x ? !x '*@!x J |  ,* !x J , |$ * * $!,` 2 8$  L$ @ 2 8  8 ` `  `"E$  L$ @Ր;  48\x 4@@hhT4px`㿈  $ $  L 쀢`9$ "<*` € 8  L$ @y2%&*  8 # L@l L@)   $ 2&    &  $   \                   㿐@#  ` `@" `J 2`'` ` `@2` @  ` * '`  H@>3)æ`   +ӑ* "@€Ѱ  L@2Ͱ &  L@"& İ `(€   ` `@"J @? 2  L@"&  6` `@2 @@ " ` @*@`'` @  `@' ` `@J "` `@2` @v "k `  *@`c'` `@ `," ,  "`@` `@2` @Z "O ` * H'` !d" @0  @Ɣ !t  &!p!, "V L@"& / L  "  L@"& % "  L@"&  2  L@"&   ,  ' , @ɏ#       <  ԝH@=!L`@+Ĵ&@L   b* ah@€$_ Ѐ   & "@& $ $ R L@1 H L`@@'  @2 @ :   *@`2$ L (€ @>Ц  $$   @2 @| "  *@` $ $   $@HP4@PPPPP XP PPPPPPPPPPPPPPPPPJJ 2  J  ( J  ( J񀠠 (㿐 4 2 `@ 8 0@1- *` `€!P@ !\` &!`€`@*& @ڐ "   4@=  㿈N`D +'LL쀦@2  &    8" L&  8"   '`8 $@L2 L   8" 0  8& 㿐  2 * $ @# ` $ *@  *`@$ $  2  *  @*`"  "* .`   $ 㿐!$! @2!$@x!  !$* $!$@P!  `!@  2  "!$!($!$$!(P@v - *!\!`"@ $ !X@ @A!P / !\*@`&!\!X@2 @2!P "# !\ *@`&!\ L 2!\@N 2L !\!X@2!\@!P "  !\* &!\ !`㿐N@ 9L  2 !\!\!X@2!\@!P "* !\* &!\!` @o  *`L " !`&!\!X@2!\@ݐ!P "  !\ *@`&!\ N@ 2L J H     *2 * " J? "* H造 J? "?*㿐@ 0@@ @  & D& L& H P@ 0 @` @ 2`@@ @ @ 0P`L` @ 0 2% L @`  8@ 0@b   <* % <@@   @Ҕ   `*`@v 2 <@i`0?@ 0 Ѥ 0 @  " `*` @Ŵ*  & ` & &&  `  @ @ ` "@ `*`  `"  @ @"`X "  ߠ @/ 2@@"0=@ @s ";  `" @ "2 $  `" `L@ L$  @} "!  $ @  "  $ $  `@i   $ @  0`D % D`H% H" "" " "  2 "   2" " "" " 㿐 " @   &@ & & & & 㿐  'L@y L L @o " `8 @L 㿐  @2 @T "  *@`$ N    $ 㿐 @;   @2 @0 "  *@`$  4   $ 㿐 "   @2  @  2  *  $ 㿐`".@`  @$` $`$`$@"[$``" @ 6@@$`"  @Ē$@@ ` `"  $`$` ?$``2`` "@ *`@C  $@`  `"  $`$` # "$``" ,$@, 2@  `&` & " $@@Q` `$`"@ ` $` $` J  *`  J  㿐  @@)  z$ @ $$ _ ڐ? @ ` ??, @ 2@W  @A * @ I ?5 , @   ?+ @` , + $@ *@ç , @$$ ` $ ??, ` @ü ,   "@& $ 㿐  , @ " @s  *@l"" " " `@(" "`@  @ "@2@ 㿐`)ɐ *` € ɐ &    @F*`    ɐ",&  ΐ!& @[$$$$0$p$$<$$$$$$$$$$$$$x㿐`ɐ!x*` € @F*`    ɐ",&  ΐ!& @%%H%d%H%H%H%%d%d%d%d%d%d%d%d%d%d%d%d%P㿐` " `` " 0 `0  !& @㿐``0  "t& @㿐```"( 0# `  t!& F   #F  ɐ#8& @㿐``0  #& @㿐``0  #& @㿐```" 0  ʐ t&  !& @x㿐``0  !& @f㿐`Bʐ!*` € @F*`   -! @F*`    # @F*`   # @F*`    !  0ʐ ,& @)))))())))))))))t))l㿐```" 0  ʐ"H&  "& @㿐``0   & @ߐ㿐` F``"$ 00   #F   ʐ#D&  !& @㿐``0  #& @㿐``0  #& @㿐` ``" 0F0  t Ѐ ː T& @n㿐``0  !& @\㿐` F``"$ 00   !F   ː!P&  !& @/㿐``0  !& @㿐``0  !& @ 㿐``0  "(& @㿐``F   "F  ː"& @א㿐``0  #@& @Ő㿐``0  !& @㿐```" 0  ΐ!&   t& @㿐``0  #& @㿐` ``" 0 0  t&   T& @n㿐` ``, 0'0$ D . @  2̰  . F   !ؐ!($  "$ @9㿐`  ``̐!|& @$㿐` ``" 0 "!(& @ 㿐``̐"& @㿐``0  "\& @㿐` ``" 0 ""& @Ր㿐`"  @``"6 01,0.G    ː#&%  @G  ( ː#&  @G  8  ̐#&  #& @㿐``0  #& @㿐``0   D& !@r㿐` G``"( 0#0  @ ΐ!& #G H  ΐ!&  "! & & %@A㿐`2͐!*` €.  @G  P !͐"8&  $͐#T &&  %ΐ H& ,ΐ H& .ΐ H&  -ΐ H& /@50555558555p555555555ȝ㿐```" 0`$ ΐ!&  '"& @ِ㿐``0  "& ,@ǐ㿐``$`" 0  ΐ!&  '"& @㿐`#ΐ *` €  % "ΐ H" ,ΐ H" .ΐ H"  -ΐ H" /@ 777777777777777777؝㿐`;ΐ!T*` €7  ? & ΐ!&- & ? & ΐ!&# ' ? & ΐ!& ( ? & ΐ!& )͐#T&  +͐#T& *@.8p9@9@9@9@9@9,9@9@8x9@9@9@9@9@9@9@9@9@9@8889㿐``ʐ t& @ ΄"?Ȅ܁" @H2X  `* 2* G* X  *  `H @2(X   `* 2* G* X  *  @H2X  `* 2* G* X  *  `H @2(X   `* 2* G* X  *  @ `0  ` `B(  @ `0@ 㿐@"S?N@ -"K`3&K? H `Aϐ!*` €& !`€ 2&1`& !d€ 2&%`& ڐ!h€ 2&`& `@"?N@ -@`@?N@ >`& `@2@?===t=t=t<<<==t=t=t=t=t=t=t=t=t=t=t=t=t=t=t=t=t=(㿐@F@ H ` `6:`` `3"`20"`w0"- ! `!ϐ#(*` €`?`  ""   "  """  `" @2@?>>??????????>>>?????>"  " $ J@Xx ` `J@Mm J` J``L`l     "㿈@@ H @  ?`А#*` €& $?!!T& $?(!X& $?/!\? @`А#T*` €`& $?!H€ "x&x`& $x?!L€ "k&k`& $k?!P€ "^&^`y쀢 "T&<` @`7А#*` €& !`€ 2?&'`& !d€ 23&`& !h€ 2'&``@"'?N@ >@`&`@2@?0쀢 " &`@ ?N@ >`& @2p@?BBBBBABB8BBBBBBBBh@A$AXBAABBBBBBBBBBA@@@@@BB@p@@BBBBBBBBBBBBBB@@BBBBB" H?" X J@J  `" 㿐@2@? H ` ѐ"*` €`@"~?N@ ]v@`@"v?N@ >`k&m (`@2@g? ` "`&` `&\ & !`€ 2&K`& !d€ 2&?`& 4!h>?€ "3`&5 ` +ѐ"*` €& &!`€ 2!&`& !d€ 2&`& !h€ 2 &``@2@& FFFFFF F<FlFFFEEFFDELE|EEEE<㿐@u H@ @  ?`hҐ!\*` €& $f?!T& $`?&!X& $Z?-!\ `LҐ *` €H`& $H?!H€ ";&;`& $;?!L€ ".&.`& $.?!P€ "!&!``@ @ @ "`  &&`2 &`@2@ ?`&  & @2@?GHH4HHhHhHHHHHHHHHHHhGGGGGHHGTGlGHHHHHHHHHHHHHHGGHHHHH؀@  H @  " `& "4 "&"`"  @ 2 @?㿐@  N@ x@ג` ` H  "` 2"`"  @ 2@?㿐@d H@ @  ?`WӐ ԓ*` €& $U?&!T& $O?-!X& $I?4!\`@ `4Ӑ t*` €0`& $0?!H€ "#&#`& $#?!L€ "&`& $?!P€ " & ``&  & @2@?KKL LPLPLPLPLPLPLPLPLPLPL@LPLPLPKKKKKLPLPKK(K@LPLPLPLPLPLPLPLPLPLPLPKXLPLPKKLPLPLPLPLP㿐@'HH H `Ԑ!*` €&  !H&  !L&  !P   H&Ӱ H @'H    ` `2&H'H  `` ;7Ԑ!ԓ*` €& ~ !`€ H( & r !d€ H & f !h€ H H  H}&H 'HHu @@`l'H  @` [Ԑ!*` €H`\'H ` @`KԐ!@*` €H I'HH& I?!T€ 7H ;'HH& ;?!X€ )H -'HH& 4!\+?€ H 'HH  &H`'HJ` > &`& H  && HH?PP@PxQOOPQQQQQPQQQOOOQQQQQOOPQQQQQPQQQOQQQOOLNNNQMMMQMMQQQNQQQQQQMOOOOOQQ㿐@̒ H@ @  ?`Ր"\*` €& $?H!T& $?O!X& $?V!\`@"?@ ` `2&`G`8`7`? `zՐ!*` €v`& $v?!H€ "i&i`& $i?!L€ "\&\`& $\?!P€ "O&O``@"O?@ `BՐ!*` €%`& !T€ "2&`& !X€ "&& `& !\€ "&``& `@?N@ >`&  & @2@?TTTUxTPTPU<UxUxUxUxUxULUxUxUxTPTTUxUxUxUxUxSSTUxTPTPU<UxUxUxUxUxULUxUxUxTPSSSSSUxUxRRRUxUxUxUxUxUxUxSDRS`UxUxUxUxSSUxUxUxUxUx㿐@2@? H ` ֐!*` €`Ӗ``@2@? ` "`& `& `@"~?N@ ]v@`@2N@t? >")&j& !`€ 2&^`& !d€ 2&R`& 4!hQ?€ "F`&H ` >֐!*` €& 9!`€ 24&.`& -!d€ 2(&"`& !!h€ 2&``@"&N` ]2 `"&N` > & `@2@& YtYtYtYtYXXXYtYtYtXXXXWWW|WWX(XXW8Wl㿐@` H@ @  ?`S֐#Г*` €& $Q?"!T& $K?)!X& $E?0!\&@  `4֐#p*` €0`& $0?!H€ "#&#`& $#?!L€ "&`& $?!P€ " & ``&  & @2@?ZZ[[L[L[L[L[L[L[L[L[L[L[<[L[L[LZZZZZ[L[LZZ4ZL[LZdZd[L[L[L[L[L[L[L[L[L[LZdZZ[L[L[L[L[LZd㿐@\ H@ @  ?`Oא"4*` €& $M?!T& $G?&!X& $A?-!\ `3א!*` €/`& $/?!H€ ""&"`& $"?!L€ "&`& $?!P€ "&`&  & @2@?\] ]T]]]]]]]]]]]]]]\\\\\]]]]]]]]]\t\\]]]]]]]]]]]]]]\\]]]]]㿐M`H Fؐ 0* €& a`€ 2'& ad€ 2'ܴ& 4ah%?€ 2'δ' ȴ"?' `8  א#ܓ*` € ?____l_l_l_l_l_l_l_l___l_l_l_l_l_l_l__h_h___^__0_h____t_t㿐@2@H? H @  ?`!:ِ"*` €` ` n-`@")?@ @`ِ"*` €`2`&  ``?`@@ @ "`  `&2 &`"&`@2@& ``&ݰ &`&ٰ `@հ?N@ ]2&`N` >2&`&Ű "ð `& `@?@ @`ِ"*` €`& $`& #`& %& `& `& `;& B!T€  `!H€ x y`& -!X€  m`!L€ c d`& !\€  X`!P€ N O` L` L? @`@ِ!*` €& !H€ "2&2`& !L€ "&&&`& ڐ!P€ "&`& `&  `&  `&  & @2@?ddde|e(e(e(e|e|e|ede|e|e|e|e(e(dXdXdXdXdXe|e|e(e|e(eLe4e(e(ccce|e|e|be|e|e|e|e|ce|e|e|e|e|e|e|e|e|cbccca`a`a`e|e|e|e|e|e|e|aDa(e|e|e|e|e|a`a`e|e|e|e|a``e|b<cXcde|apac,``e|e|e|e|e|c<b,adTdTd`d`d`e|e|bbbe|e|bc㿐@G?`єB"? "< ' H@ @`.ڐ *` €(`&`$`@ #""! @ ސ`"@ 2"`@?@ @` "`"  @ ͐`"`@2@" hhhggghh4h hhhhhhhhhhhp㿐@F?`pA`.<"9  H@ @`+ڐ"$*` €%`#`!`@ ߐ "@ ߐ"@ ߐ`"@ 2"`@?@ @` "`" `@2@" ijiti|ijiijjjjjjjjjjjjjjjjjji`@ ' @`HڄD( 2`" ?(" `+ 8$@"`" `@ 2 @ k(k(kkk(k(k(k(k(k(k(kjjk(k(jk(kkk(k(k(k(k(k(㿐`  @H?(" 2` / & . |` 2y` / & . o` 2l` / & . b` 2Ͳ`\ / & V.   / ` K `   / ` > ` 2` /  3  " 2`6`/ H "`@ N@  `H2`(   2z`6w`/ ( n`mn kl$lXn mmnlln n n nn n n mHlln n n n l㿐`N@ x( `N@ ;4@*`: Ѐ`6ې#*` €Й+ + ?ə+ ? ?#`N@ ;@0? ;?#+  * N@?И `N@ ;+ @& nnnnnnnnnnooooooonnnnnnoooooooooooooooooooooooooonnnnnn" "J@ 0D 0AJ`t>J@`g`l86 <4 >a1 `J@m,J`p(& &J@aq  `J@u`J@oJ`t "`J@p  `J@oJ`s '  @`H )܄(J*8,`J@J`&J@J` J@J`J*8`Ք J*8  ܄(  rrrrrrrrrrrrrrrrrrrrrrrrrqqrdrdrdrdrdrdrdrdrdrdrdrdrdrdr@r@r@r@r@rdr@ J(J@8J` @ H? ܄(  ssssssssssssssssssssssssܔ  @H?݄(````"@ tttttttttttttttttttttttt H @   ` @ / @`H!݄(```?""`@ " @  "`?"`@ "uuuuuu@"# $@ (@ 2 @(@ "@ *  "@"㿐@@Q@"O"@ H?677@"`.`58.`18``(?0@`+```?. (?0@`````` ?`(. `?.`?0 0@0```0@``@@2@"@"@ /`"#&3`*  `?"* @ " "@@ `@+@"@"@  `"#ސ@@   @`2 "@@ " 2 @@@   @`* "@@ " 2 @ ?('ބ(     `` `  yyyyyyyyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzy㿐@"U?N` 2G&N@ -"I`A&I? @ H N@`7ߐ *` €& `.@& `(@& ޲`"@`@"!?N` @N@ -@`@"?N` 2&N@ >`&  & `@2N`?{{{{{{8{P{h{{{{{{{{{{{{{{{{{{{㿐@"^?N` @ H @N@   6J`  `C&2A&`n@&= !  H@ @ N@?`)ߐ"*` €`"'?N` ` H  N` "&   &  "&&  `& @2N`?}}}}}}}}}}}}}}}}}}}}}\"  " 1 J`?J@Xx' ` `J`?J@Mm ` `J`2?J@`L`l     "㿈@ N`  H@ @N@?`"*` €`HaX @ G@* 2 * X  * *@& 4&?  H@ @gN@?`"*` €`H"X G@*`2@X*`  * "o&o`& o?g&& i?a&& c?[&^쀢 "S&7` @ H %N@`)"\*` €& ` @& `@& `@`@"/?N`  @N@ >@`#&`@2N`?쀢 "&`@"?N` 2&N@ >`& @2lN`?88H`x888888888888@888888888888888888" H?X J`2"J@J " `" 㿐@&? ?6@N` @ H gN@` z"X*` €`@"w?N` o@N@ ]k@`@"k?N` 2bN@ >`\&^ (`@2N`X?   H@ @ " ` &/N@ 2&`&E `&A & `7@& `1@& ,`/?&, @ H N@` ",*` €& $&`& $& `& $ &``@2N`&   pp  @(@Xp㿐@"?N`  H@ @N@?`y!,*` €`HaX @ G@* 2 * X  * *@& 4`&d?  H@ @N@?`P ̓*` €`H"X G@*`2@X*`  * ":&:`& :?2&& 4?,&& .?&&`@' HN` @ZN@ "`  &&`2 &`@2N` ?`&  & @2N`?$㿐@"5?N` @ H N@ 4"& &&`@  HN` @N@ " ` 4 & &&`&  & @2N`?㿐@"=?N``  @`x *`.*:  2*` ` H :` 2&`@ HN` @N@  2&``&  @2N`?㿐@"p?N`  H@ @N@?`[!*` €`HaX @ G@* 2 * X  * +@`E  H@ @YN@?`1!D*` €`H"X G@*`2@X*`  * "&`& ?&& ? && ?&`&  & @2N`?              x                 Н㿐@+'HHJ`  @`H @J@?`#*` €HH `"X G @*`2@X*`  * Hא H& ?&H& ?&H& ?&`H  HH@'HJ`  @J ꀢ `Hƀ` `HH@'HJ`   xJ 耦` ,H)#\*` €H& ` 'HH& ~`'HH& w`'HH`H  HH&H 'HH@?J`  @`H 7J@@Ā`H@p'HJ` `H  @#J?` Z#(*` €H@W'HJ` `H  @ J?`A"ȓ*` €HH `!X G @*`2@X*`  * H&/ H &'HH& 4&$?H  &H@'HJ` 2&J >& &  H &HH?PP8LP  PP8LPd,H|     l㿐@"ٰ?N`  H@ @hN@?` *` €`HaX @ G@* 2 * X  * S@`@"?N` @ H @N@  2&`v```V  H@ @N@?`r#*` €`H"X G@*`2@X*`  * "\&\`& \?T&& V?N&& P?H&`@"J?N`  H@ @N@?`5#T*` €`H!X G@*`2@X*`  * "&`͖`& `@?N` 2 &N@ >2&`&  & @2N`?0000000000000x00000000000000000 00000000<㿐@&? ?@?N` @ H :N@` #*` €```@2N`?   H@ @ " ` &N@ 2&`&{ `&w `@"s?N` k@N@ ]g@`@2N`e? 2]N@ >"&W& `R@& `L@& G`J?&G @ H N@` 4#|*` €& $0&*`& $*&$`& $$&``@"&N` 2 N` ]2 `"&N` 2  N` > & `@2N`& lllllllTT $<T,㿐@"l?N`  H@ @kN@?`W!*` €`HaX @ G@* 2 * X  * '@&E   H@ @EN@?`1!*` €`H"X G@*`2@X*`  * "&`& ?&& ? && ?&`&  & @2N`?0Hpppppppppp`pppp0Hpttpppppppppptpppp0t㿐@"n?N`  H@ @N@?`Y *` €`HaX @ G@* 2 * X  * *@& 4@&D?  H@ @N@?`0 *` €`H"X G@*`2@X*`  * "&`& ?&& ? && ?&&  & @2N`?X㿐"I?N `H !N 9"* €& 瀦& ဦ& ܴ$?'! Դ"?'N `H @N?`  "0*` €    Xp   㿐@]?& ?W?@N`  H@ @N@?`!A!*` €` ` e4`@0?N`  H@ @N@?`!0*` €`(`і&  ``?`@  HN` @TN@ "`  `&2 &`"&`@2N`& `ٰ`&հ &`&Ѱ `@Ͱ?N` 2&N@ ]2&`N` 2 &N` >2&`& " `& `@?N`  H@ @N@?` ē*` €`& $`& #`& %& `& `& `z s` H`!X G@*`2@ X*`   *  ]`H"X *`@ *` P Q`  H@ @N@?`A H*` €`H"X G@*`2@X*`  * "+&+`& +?#&& %?&& ?&& `&  `&  `&  & @2N`?$$$$ $$$$ddddd$<$$$$$$$$$$$$$$$$$$   $$$$$$$$$$$$  $$$$ x$$44<T$$$$$D4``lll$t|$$$㿐@X?`OR&O &L 'N`  H@ @N@?`8#*` €2`0`@ܐ/&&- @ڐ`'&@2$&`@"!?N`   H@ @ " ` &N@ 2&`&  @`&`@2N`& ppppppppppppp\㿐@X?`ݖR`L&I N`  H@ @WN@?`5!X*` €/`-`@ِ,&@ڐ'&@ې`"&@2&`@"?N`   H@ @ " ` &'N@ 2&`& `@2N`& 888888888888888888888㿐`@"9 N`  H@ @N@?`*`" €N` 2`N@ 2`&N`  ?N@?"`N` ?N@ $ @"`& `@2N` ppp(PPpp㿐`  )N` H@ @N@? * !@€2` . & * `2` . & * v`2Ӳ`p . & j*   . `" _ `   . `" R ` 2` . " G 62`6`.   J` "``@!N` N@ N` `` " 2 *`H @@ {`:`2v`*  2l`6i`. * ``|| T㿐`N` G N@ x2BN``N`  ?N@ ;@N` ?N@Ѐ 6#+` €+  + ?ə+ ? ?# `N` ?N@ ;2N`0? ?N@+  * ??@ #`N` 2N`N@ ;2N`@ ؔ" "!J` 0r2 0oJ`lJ`thJ`2?J@`g`l^ \ <Z >W J@aS`J`OJ@mK`J`GJ@pCA &J`?J@aq7 `J`2J@u.`J`*J@o&`J`"J@t "`J` J@p`J`J@o `J`J@s ' 㿐N`  H@ @N@?`. *` €N@N`@6N@N`@0N@N`@*N@N`@ NN@@`NN@@`"N` N  H @N?` #*` €  LLLLLLLLLLLLLLL㿐NN` 2$ *`N@: @2 N` N`  H@ @6N@?` !*` €                 㿐N`  H@ @N@?` !*` €```&@ܝ㿐 HN` @N@   `㿐@?N`  H@ @N@?`+#*` €%`#`? &&` @&N`   H@ @  ? &N@ ?`?&`@ & ,㿐"u#  6 `#4 &22 "Z#(R'R(`0.@``?&.`B`'B`06 ( .@`&.```?& .`+`'+`6 (6 (8 /@`&?/``&  `  (. 6`/```?&`/`` &#@#"$@ "@  (3@`" "@@ 2㿐@"U?N@ 2G&N` -"I`A&I? ` H N``7#*` €& `.@& `(@& ޲`"@`@"!?N@ @N` -@`@"?N@ 2&N` >`&  & `@2N@? $㿐@"^?N@ ` H WN`   6J`  `C&2A&`n@&= !  H` @7N`?`)!*` €`"'?N` ` H  N` "&   &  "&&  `& @2N@?ttt"  " 1 J@?J`Xx' ` `J@?J`Mm ` `J@2?J``L`l     "㿈@ N@  H` @N`?`"*` €@HaX @ G`* 2 * X  * *@& 4&?  H` @~N`?`"@*` €@H"X G`*`2@X*`  * "o&o`& o?g&& i?a&& c?[&^쀢 "S&7` ` H @`#&`@2N@?쀢 "&`@"?N@ 2&N` >`& @2lN@?ttttttttt44Ld||Ō|,,,,,4LÄ,,@" H?X J@2"J`J " `" 㿐@&? ?6@N@ ` H ~N`` z!*` €`@"w?N@ o@N` ]k@`@"k?N@ 2bN` >`\&^ (`@2N@X?   H` @ " ` &FN` 2&`&E `&A & `7@& `1@& ,`/?&, ` H N`` !Г*` €& $&`& $& `& $ &``@2N@& ɰɰhɀɘɰɰXȼ㿐@"?N@  H` @N`?`y Г*` €@HaX @ G`* 2 * X  * *@& 4`&d?  H` @N`?`P p*` €@H"X G`*`2@X*`  * ":&:`& :?2&& 4?,&& .?&&`@' HN@ `qN` "`  &&`2 &`@2N@ ?`&  & @2N@?xː˨L<LLLLLLLLLpppppL(xːLLLLLLLLLLLLLLppLLLLʄ㿐@"5?N@ ` H N` 4"& &&`@  HN@ `N` " ` 4 & &&`&  & @2N@?㿐@"=?N@@  ``x *`.*:  2*` ` H ˓:` 2&`@ HN@ `N`  2&``&  @2N@?㿐@"p?N@  H` @N`?`[!H*` €@HaX @ G`* 2 * X  * +@`E  H` @pN`?`1 *` €@H"X G`*`2@X*`  * "&`& ?&& ? && ?&`&  & @2N@?lЄМдdddddlЄМϸddt㿐@-'HHJ@  ``H @J`?`#,*` €HH @"X G `*`2@X*`  * Hِ H& ?&H& ?&H& ?&`H•  HH  'HJ   @J` ꀢ `HȀ` `HH  'HJ    J` 耦` ,H)#*` €H& ` 'HH& `'HH& y`'HH`H  HH&H 'HH@?J@  ``H NJ`@Ā`H  r'HJ   `H @9J`?` ["ԓ*` €H  X'HJ   `H @J`?`A"t*` €HH @!X G `*`2@X*`  * H&/ H &'HH& 4&$?H  &H@'HJ 2&J` >& &  H &HH?dҀHHHHHHHHHոոHHHH`HHHHHHHHHHH<ӴHdҀҜHҸҸHHH HHHHHHҸոոոոոH㿐@"ٰ?N@  H` @}N`?`#*` €@HaX @ G`* 2 * X  * S@`@"?N@ ` H UN`  2&`t```T  H` @+N`?`r#`*` €@H"X G`*`2@X*`  * "\&\`& \?T&& V?N&& P?H&`@"J?N@  H` @N`?`5#*` €@H!X G`*`2@X*`  * "&`˖`& `@?N@ 2 &N` >2&`&  & @2N@?ـٰ٘ڌڜll$ـٰ٘ڌڜxxxxx0ـٰ٘ذ,xx㿐@&? ?@?N@ ` H ON`` #T*` €```@2N@?   H` @ " ` &&N` 2&`&{ `&w `@"s?N@ k@N` ]g@`@2N@e? 2]N` >"&W& `R@& `L@& G`J?&G ` H N`` 4#(*` €& $0&*`& $*&$`& $$&``@"&N` 2 N` ]2 `"&N` 2  N` > & `@2N@& ޜTlބܠܼLݸ<㿐@"l?N@  H` @N`?`W!*` €@HaX @ G`* 2 * X  * '@&E   H` @ZN`?`1!@*` €@H"X G`*`2@X*`  * "&`& ?&& ? && ?&`&  & @2N@? t    㿐@"n?N@  H` @N`?`Y H*` €@HaX @ G`* 2 * X  * *@& 4@&D?  H` @N`?`0#̓*` €@H"X G`*`2@X*`  * "&`& ?&& ? && ?&&  & @2N@?TlLLLLLTlLL`㿐"I?N `H 6N 9"0* €& 瀦& ဦ& ܴ$?'! Դ"?'N `H @N?`  !ܓ*` € PPPPPPPPPPPPPPPLL4LXX㿐@]?& ?W?@N@  H` @N`?`!A!<*` €` ` e4`@0?N@  H` @N`?` ܓ*` €`&`ϖ&  ``?`@  HN@ `iN` "`  `&2 &`"&`@2N@& `ٰ`&հ &`&Ѱ `@Ͱ?N@ 2&N` ]2&`N` 2 &N` >2&`& " `& `@?N@  H` @N`?` p*` €`& $`& #`& %& `& `& `z s` H@!X G`*`2@ X*`   *  ]`H"X *`@ *` P Q`  H` @N`?`A#*` €@H"X G`*`2@X*`  * "+&+`& +?#&& %?&& ?&& `&  `&  `&  & @2N@?8Ph$8Ph   t(8Н㿐@X?`MR&O &L 'N@  H` @N`?`8#<*` €2`0`@ܐ/&&- @ڐ`'&@2$&`@"!?N@   H` @ " ` &N` 2&`&  @`&`@2N@& |hX`㿐@X?`ۖR`L&I N@  H` @lN`?`5!*` €/`-`@ِ,&@ڐ'&@ې`"&@2&`@"?N@   H` @ " ` &W J`aS`J@OJ`mK`J@GJ`pCA &J@?J`aq7 `J@2J`u.`J@*J`o&`J@"J`t "`J@ J`p`J@J`o `J@J`s ' 㿐N@  H` @N`?`.#*` €N@N`@6N@N`@0N@N`@*N@N`@ NN@@`NN@@`"N@ N  H @ߦN?` #X*` €  DDDLLLLLLLLLLLLLLDDDDDLDt\㿐NN@ 2$ *`N`: @2 N` N@  H` @KN`?`  ē*` €  㿐N@  H` @N`?` !*` €```&@x㿐 HN@ `N`   `㿐@?N@  H` @N`?`+#`*` €%`#`? &&` @&N@   H` @  ? &ޥN` ?`?&`@ &@@㿐"u#  6 `#4 &22 "Z#(R'R(`0.@``?&.`B`'B`06 ( .@`&.```?& .`+`'+`6 (6 (8 /@`&?/``&  `  (. 6`/```?&`/`` &#@#"$@ "@  (3@`" "@@ 2 @ `(*(82   㿐 E?  H <"=?  H0#`4-H *H/?*  @ "J?`<JH"@ J#@ H#`## !J!&"  #`.` &㿐 㿐 㿐H#`TI K!T㿐(Kbs I"8,&@Kbi H#`"&@Kb_ I#&@KUb耢  #c &@&& & 0& @& H 㿈 8'H'H@耢?O "  4   0   㿐@֔ "I'@ @@ ˔ 2 @@2&&] А " @ @@ Š 2 @ ="#'@@? =@"'@ @@  2 @ " '" @'@%  @, @:`' ?  ?Ѐ  . - _2'@ @@m? @@ '@p'l 8'HHl@H2= l *@   , L 2 Kbz K1H #`bq K1I"8bh K1I#_b耢 "  @ 1J#㿈`@* @* & L\ ` d '''L$ 쀢`KwL` ` ''@L \L  lLU K` )ɔ  A耤`$@L`@T" $LҔ (L "> K`  K`    $K`(   '2$L`@ 'LLt L2'  :` ? 0  0I8H   ??@?  & *0  ? ?:**& ?:: ?? ?*** :  : ?? `? ?:****   ??2 ?   #: ?? 22 't㿐!p!l€?2 HbX;  @ :*  G`X* @  . 㿐!p!l€?2 HaX;  @ :*  G`X* @  . 㿐!p!l€?@ E  P@0 H@ @* #tN !l€!pL' @ @ ?&@'`&@? *@`&@2@㿐@@#!t H @* @ `!l!p@ ?&@&@@2 @&2 @㿐I"8'L'P @ .`ak( @ I"   ,`@2 ``$ I"H<bX  H #!t#t#u  @? ', ?* ",,G5  2` !t,, ,42@22@ ?,5,(,c HE aX<  @ :`* G `X*   *   @ *  * @   ,,5` ```PL&!p`&!l!XaȔ8&!P&!\&!h&!H&!L&!T&!X&!`&!d"cT& 8& <㿐/  @f@А@㿐/<  ??㿐㿠x|㿠xEusage: %s FILE FILE must be the name of an l-format file with column headings created by `bxb', `rxr', `mxm', or `epic' r%s: can't open %s %s: input file %s is empty or unreadable %s: input file %s does not appear to be a `bxb', `rxr', `mxm', or `epic' -l or -L file with column headings %s%s: illegal format in %s: ______________________________________________________________________________________ Sum %6ld %3ld %3ld %3ld %3ld %4ld %3ld %3ld %3ld %3ld %3ld Gross %6.2f %6.3f Average Total QRS complexes: %ld Total VEBs: %ld ____________________________________________________________________ Sum %4ld %4ld %4ld %4ld %4ld seconds _______________________ Sum %4ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld Gross %3.0f Average Total couplets: %ld Total short runs: %ld Total long runs: %ld ________________________ Sum %6ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %3ld %4ld %3ld %3ld %3ld %3ld %3ld %3ld Average Total QRS complexes: %ld Total VEBs: %ld Total SVEBs: %ld __________________ Sum %4ld %4ld %4ld %4ld %4ld %4ld seconds Sum %4ld %4ld %4ld %4ld %s %s Gross Average __________________________________________________ Average %7.4f %g Summary of results from %d record%s s@Y%s%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%s%ld%ld%ld%ld%s%s%s%s%ld%s%d%d%d%d%d%d%d%d%d%d%d%d%s%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%ld%s%s%s%s%s%s%lf%s%ld%ld%ld%ld%ld%s%s%s%s%s%ld%s%ld%ld%ld%ld%s%s%s%s%s%s%s%lf%lf @Y -@Y -@Yheaderinit: can't open header for record %s init: can't find record name in record %s header init: record %s cannot be nested in another multi-segment record init: record name in record %s header is incorrect init: number of signals in record %s header is incorrect init: sampling frequency in record %s header is incorrect warning (init): record %s sampling frequency differs from that of previously opened record init: number of samples in record %s header is incorrect record %s duration differs init: insufficient memory init: unexpected EOF in header file for record %s init: `%s' is too long for a segment name in record %s init: length must be specified for segment %s in record %s warning (init): sum of segment lengths (%ld) does not match stated record length (%ld) init: illegal format for signal %d, record %s init: error in specification of signal %d or %d record %s, signal %dinit: obsolete format in record %s header ?-isgsettime: incorrect signal group number %d isigsettime: improper seek on signal group %d isigsettime: can't open segment %s getvec: unexpected EOF in signal %d getvec: error opening segment %s getvec: checksum error in signal %d isigopen: record %s has no signals isigopen: none of the signals for record %s is readable isigopen: can't allocate buffer for deskewing osigopen: attempt to open too many output signals osigopen: record %s has fewer signals than needed osigopen: can't open %s osigopen: can't allocate buffer for %s osigfopen: error in specification of signal %d osigfopen: incorrect file name or group for signal %d osigfopen: error in specification of signal %d or %d osigfopen: can't open %s osigfopen: can't allocate buffer for %s osigfopen: insufficient memory Aputvec: write error in signal %d setibsize: can't change buffer size after isigopen setibsize: illegal buffer size %d setobsize: can't change buffer size after osig[f]open setobsize: illegal buffer size %d recordnewheader: can't create header for record %s %s %d %g/%g(%g) %ld %s%s %s %dx%d:%d+%ld %g(%d) /%s %d %d %d %d %dsetmsheader: record must contain at least one segment setmsheader: insufficient memory setmsheader: `%s' is too long for a segment name in record %s setmsheader: can't read segment %s header setmsheader: length of segment %s must be specified setmsheader: incorrect number of signals in segment %s setmsheader: incorrect sampling frequency in segment %s setmsheader: can't create header file for record %s %s/%u %d %g%s %ld getinfo: can't read record %s header getinfo: caller did not specify record name putinfo: header not initialized (call `newheader' first) #%s setsampfreq: sampling frequency must not be negative A%02d/%02d/%d%d:%d:%dsetbasetime: incorrect time format, '%s' .]%2d:%02d:%02d.%03d %2d:%02d.%03d[%02d:%02d:%02d.%03d%s]?@@?@N@ %02d/%02d/%d?@Ո@^fffff@v@@>'RTa@v?v@>'RTa?zG{@i@@?@i?PbM?@i@i?WFDBWFDB=%s. http://www.physionet.org/physiobank/databaseWFDBCALWFDBCAL=%swfdbcalwfdb_parse_path: insufficient memory getwfdb: files nested too deeply rbwfdb_addtopath: insufficient memory WFDB library version %d.%d.%d (%s). Jun 10 2000%s-header%s.%swb%s.%s.%.3sinit: illegal character %d in %s name WFDB_PAGESIZE%d.%d.%dContent-Length%ld-%ldbytes*/*www_get_url_range_chunk: fatal error requesting %s (%s) nf_new: requested %ld, got %ld bytes from %s nf_new: insufficient memory (needed %ld bytes) nf_get_range: requested %ld bytes, received %ld bytes nf_get_range: couldn't read %ld bytes of %s starting at %ld nf_get_range: requested %d bytes, received %d bytes wfdb_fopen: out of memory HTAccess.... Accessing document %s wbHTLoadToFile*/*application/x-www-rules%s?%sPosting Data from callback function Posting Data No document text/*Posting Data Must know the length of document %p Posting Data Target WOULD BLOCK Posting Data Target PAUSED Posting Data Target is SAVED using chunked Posting Data Target is SAVED Posting Data. Target returns %d Posting Data Target ERROR %d file:application/x-www-form-urlencodedPrecondition %d not understood Posting..... Bad method Save Filter. Using context %p with state %c Save Filter. Waiting for authentication Save Filter. Destination hae moved! HTPutDocumentAnchorHTAccess.cPut Document No source Copy........ BAD ARGUMENT Copy Anchor. No destination found or unspecified method Copy Anchor. Bad anchor setup %p Upload...... No destination found or unspecified method Uploading... from callback function POST Anchor. Target WOULD BLOCK POST Anchor. Target PAUSED POST Anchor. Target returns %d POST Anchor. Target ERROR HTAccess.... Serving %s The server has sent you a cookie - accept?The persistent cache is already in use by another user. If this is not the case then you can manually delete this lock and restart.An automatic request for changing proxy has been encountered - continue?A redirection may change the behavior of this method - proceed anyway?The destination document for this operation has moved - continue operation with new location?The source document for this operation has moved - continue operation with new location?This document is very big - continue operation?This method has already been performed - repeat operation?Proxy authentication failed - retry?Authentication failed - retry?This file already exists - replace existing file?A new set of rules is requested to be added to your setup - continue?Location has moved, continue?You might not be allowed to use this method here, continue?Plase enter account:Please give name of file to save in:Password:Please enter username for this FTP server:Please enter username for proxy authentication:Please enter username:Automatic proxy redirection must be explicitly acknowledgedLoading new rules must be explicitly acknowledgedThis version has expired and will be automatically reloadedWhen you are connected, you can log inAccess scheme not allowed in this contextWrong or unknown access schemeoperation failedCan't connect to WAIS-serverWAIS-server doesn't return any dataResponse from WAIS Server too Large - Extra lines ignoredPremature End Of FileMethod not suited for automatic redirectionToo many redirectionsTrying `ftp://' instead of `file://'News-server repliesUnknown access authentication schemeBad, Incomplete, or Unknown ResponseThis is probably a HTTP server 0.9 or lessCSO-server repliesConnection establishment interruptedData transfer interruptedGopher-server repliesServer timed outFTP login failureFTP server doesn't replyFTP server repliesNo file name found or file not accessibleNo host name foundinternalCan't locate remote hostCache warningTransformation AppliedHeuristic ExpirationDisconnected OpeartionRevalidation FailedcacheResponse is StalePartial update Not ImplementedHTTP Version not supportedGateway TimeoutService UnavailableBad GatewayNot Implementedserver_errorInternal Server ErrorProxy Reauthentication ReuiredReauthentication RequiredExpectation FailedRange Not SatisfiableUnsupported Media TypeRequest-URI Too LargeRequest Entity Too LargePrecondition FailedLength RequiredGoneConflictRequest TimeoutProxy Authentication RequiredNot AcceptableMethod Not AllowedNot FoundForbiddenPayment RequiredUnauthorizedclient_errorBad RequestTemporary RedirectProxy RedirectUse ProxyNot ModifiedSee OtherFoundMoved PermanentlyredirectionMultiple ChoicesPartial Update OKPartial ContentReset ContentDocument UpdatedNon-authoritative InformationAcceptedCreatedsuccessOKSwitching ProtocolsinformationContinueLooking up Contacting Waiting for connection...Logging in...%d%%Read ( of )Read bytesReading...Writing (Writing Writing...Done!Interrupted!Working - please wait...Request timeout - server did not respond.UNKNOWN PROGRESS STATE@YWarning: Non Fatal Error: Fatal Error: Information: UNKNOWN ERROR TYPE%d Reason: () This occured in %s %s (%s) (y/n) YESY%s (%s) (RETURN for [%s]) %8p: %3d %6d %8p %8p %8p event: pri millis callback param request %8p: %6d %ld %c %8p timer: millis expires ? param callback Event....... Dumping socket events soc %3d xcptwritread%s ............ READ : %d............ WRITE:............ OOB :............ Timeout is %ld s, %ld microsecs Event....... READ timed out on %d. Event....... WRITE timed out on %d. Event....... OOB timed out on %d. Event....... No event for timer %p with context %p HTEvtLst.cBad timer %p HTEventList_registerEventOrder.. no event found for socket %d, type %s. EventOrder_addEventOrder.. execute ordered events EventList... calling socket %d, request %p handler %p type %s EventOrder.. all ordered events Event....... Reset MaxSock from %u to %u Event....... Register socket %d, request %p handler %p type %s at priority %d Event....... Registering socket for %s HTEventList_register: (s:%d)Event....... New value for MaxSock is %d HTEventList_unregister: (s:%d)Event....... No more events registered for socket %d Event....... Socket %d unregistered for %s Event....... Couldn't find socket %d. Can't unregister type %s Unregister.. all sockets Dispatch.... Handler %p NOT called Dispatch.... Bad socket %d Event Loop.. calling select: maxfds is %d Event Loop.. select returns %d Event Loop.. select was interruted - try again Event Loop.. One or more sockets were not through their connect phase - try again Event Loop.. select returned error %d HTRuleFilterMem Cache... We only check GET methods Mem Cache... No fresh document... Mem Cache... Document already in memory Load End.... NOT AVAILABLE, RETRY AT %ld Load End.... EMPTY: No content `%s' Load End.... OK: `%s' Load End.... Request ended with code %d Redirection. No destination Redirection. Changing method from %s to GET PERMANENT_REDIRECTIONTEMPORARY_REDIRECTIONSEE_OTHERHTRedirectFilterUse Proxy... No proxy location httpHTUseProxyFilterCredentials. verified HTCredentialsFilter*/*www/debugmessage/rfc822message/x-rfc822-footmessage/x-rfc822-headmessage/x-rfc822-contmessage/x-rfc822-upgrademessage/x-rfc822-partialmultipart/*text/plaintext/htmltext/x-httptext/x-nntp-listtext/x-nntp-overtext/xmlapplication/xmlwww/unknownwww/cachewww/cache-appendapplication/x-www-ruleswww/presentDISPLAYapplication/postscriptghostview %simage/gifxv %simage/tiffimage/jpegimage/pngchunkedhttp://*basicdigesttcpbuffered_tcplocalftpnntpnewsgopherhttpfilecachetelnettn3270rlogin/icons/blank.xbmdirectory.xbmDIRback.xbmUPunknown.xbmbinary.xbmBINbinarytext.xbmTXTtext/*image.xbmIMGimage/*movie.xbmMOVvideo/*sound.xbmAUaudio/*tar.xbmTARmultipart/x-tarmultipart/x-gtarcompressed.xbmCMPx-compressGZPx-gzipindex.xbmIDXapplication/x-gopher-indexindex2.xbmCSOapplication/x-gopher-csotelnet.xbmTELapplication/x-gopher-telnetDUPapplication/x-gopher-duplicateTNapplication/x-gopher-tn3270*HTIconInitHTInit.c/usr/local/share/w3c-libwww/acceptaccept-charsetaccept-encodingaccept-languageaccept-rangesauthorizationcache-controlconnectioncontent-encodingcontent-lengthcontent-rangecontent-transfer-encodingcontent-typedigest-MessageDigestkeep-alivelinklocationmax-forwardsmime-versionpragmaprotocolprotocol-infoprotocol-requestproxy-authenticateproxy-authorizationpublicrangerefererretry-afterservertrailertransfer-encodingupgradeuser-agentvaryviawarningwww-authenticateauthentication-infoproxy-authentication-infoOXOXOXOXOXOOYPZP[PP0[P@[PP\Pp\lPa8P]HP^TP`Pa0PPaXPaPb,QbQ YQ8bQPc(QXcQ`cQhcQxcQdQd,QdQeQe@QeQeQYQYTRb/WWW_HOME/etc/www-remote.urlrmy_home_document HTHome.chttp://www.w3.org/HOMEHTLocalName%s/%sWWW/default.html/usr/local/lib/WWW/default.htmlHome Anchor. No local home document in ~/%s or %s file:Home Anchor. `%s' used for custom home page as `%s' HTTmpAnchor%s.%ld.%dTmp Anchor.. With location `%s' Form data... Adding name `%s' with value `%s' to %p Trace....... Bad argument Log......... No log file given HTLog_openHTLog.cLog......... Open log file `%s' awLog......... Can't open log file `%s' Log......... Closing log file %p Log......... Writing CLF log localhost - - [%s] %s %s %d %ld Log......... Writing Referer log %s -> %s %s add_objectHTProxy.c/HTProxy..... replacing for `%s' access %s HTProxy..... adding for `%s' access %s add_hostnameHTHostList.. adding `%s' to list GetProxy.... No proxy directive found: `%s' GetProxy.... Found: `%s' GetGateway.. Found: `%s' gopherwaisnewsftphttpProxy....... Looking for environment variables _proxyWWW__GATEWAYno_proxyHTRule_addHTRules.cRule Add.... For `%s' op %d `%s' Rule Add.... For `%s' op %d Check rules. for `%s' HTRule_translate............ map into `%s' ............ FAIL `%s' Rule Parse.. `%s' Rule Parse.. Insufficient operands: `%s' addtype%lfbinaryaddencodingaddlanguagepresentation%lf%lf%lfproxynoproxy%dgatewaymappassfailRule Parse.. Bad or unknown: `%s' Rules....... FREEING.... Rules....... ABORTING... Z4454@4`3RuleParserRule file... Parser object created HTRulesRule file... Automatic parser object created &<&%d;=":L:;(;\<=@text/htmlHTMLGeneratorHTMLGen.cHTMLGen..... Can't convert to media type [7\=>:L:;(plaintexttoHTMLPlainToHTMLtext/htmlwww/presenttext/plaintext/x-ctext/latexyumlyacuteuumlugraveucircuacutethornszligquotoumlotildeoslashograveocircoacutentildenbspltiumligraveicirciacutegteumlethegraveecirceacuteccedilaumlatildearingampagraveaeligacircaacuteYacuteUumlUgraveUcircUacuteTHORNOumlOtildeOslashOgraveOcircOacuteNtildeIumlIgraveIcircIacuteEumlEgraveEcircEacuteETHCcedilAumlAtildeAringAgraveAcircAacuteAEligVLINKTITLETEXTSTYLELINKLANGIDDIRCLASSBGCOLORBACKGROUNDALINKTARGETSRCSCROLLINGLONGDESCNORESIZEMARGINWIDTHMARGINHEIGHTNAMEFRAMEBORDERROWSCOLSTYPETABINDEXSHAPEREVRELHREFLANGHREFCOORDSCHARSETACCESSKEYWIDTHVSPACEOBJECTHSPACEHEIGHTCODEBASECODEARCHIVEALTALIGNNOHREFCITECLEARVALUEDISABLEDSPANDATETIMESIZEFACECOLORMETHODENCTYPEACTIONACCEPT-CHARSETACCEPTPROFILENOSHADEVERSIONUSEMAPISMAPBORDERREADONLYMAXLENGTHCHECKEDPROMPTFORCOMPACTMEDIASCHEMEHTTP-EQUIVCONTENTNSTANDBYDECLAREDATACODETYPECLASSIDSTARTLABELSELECTEDVALUETYPELANGUAGEDEFERMULTIPLESUMMARYRULESFRAMECELLSPACINGCELLPADDINGVALIGNCHAROFFCHARSCOPEROWSPANNOWRAPHEADERSCOLSPANAXISABBRVARULUTTTRTHEADTHTFOOTTEXTAREATDTBODYTABLESUPSUBSTRONGSTRIKESMALLSELECTSCRIPTSAMPSQPREPARAMPOPTIONOPTGROUPOLNOSCRIPTNOFRAMESNEXTIDMENUMETAMAPLILEGENDKBDISINDEXINSINPUTIMGIFRAMEIHTMLHRHEADH6H5H4H3H2H1FRAMESETFORMFONTFIELDSETEMDTDLDIVDFNDELDDCOLGROUPCOLCENTERCAPTIONBUTTONBRBODYBLOCKQUOTEBIGBDOBASEFONTBASEBAREAAPPLETADDRESSACRONYMA \end{itemize} \begin{itemize}} \author{} \maketitle \title{ \end{verbatim} \begin{verbatim} \end{enumerate} \begin{enumerate} \item _FIGUR_ \subparagraph{ \paragraph{ \subsubsection{ \subsection{ \section{} \chapter{{\em \item[ \end{description} \begin{description}]{\tt \cite{{\sf {\bf }{\it \"{y}\'{y}\"{u}\`{u}\^{u}\'{u}\ss "\"{o}\o \`{o}\~{o}\'{o}\~{n}<\"{\i}\`{\i}\^{\i}\'{\i}>\"{e}\oe \`{c}\^{c}\'{e}\c{c}\"{a}\~{a}\aa &\`{a}\ae \^{a}\'{a}\'{Y}\"{U}\`{U}\^{U}\'{U} \"{O}\~{O}\O \`{O}\^{O}\'{O}\~{N}\"{I}\`{I}\^{I}\'{I}\"{E}\`{E}\^{E}\'{E}\OE \c{C}\"{A}\~{A}\AA\`{A}\^{A}\'{A}\AE $\backslash$$\hat{ }$$\tilde{ }$,;:[]()LaTeX....... No Markup in verbatim mode LaTeX....... No markup in verbatim mode \end{document} iBHHBEEF,GGH H@H`HTMLToTeXHTTeXGen.c\documentstyle[11pt]{report} \begin{document} j0JJJ4IIIPlainTextHTPlain_newHTPlain.c" <>&HTML Parser. Doesn't support this character set HTML Parser. Anchor `%s' HTML Parser. Image map area `%s' HTML Parser. New base `%s' HTML Parser. Background `%s' HTML Parser. Frame `%s' www/unknownHTML Parser. Maximum nesting of %d exceded! HTML Parser. Bottom of parse stack reached nVWXLKKK$KUdVTWWPWtext/htmlHTML_newHTML.c/* /* */ HTextImp_newHText.c%s:%u: failed assertion `%s' SGML.ctag->number_of_attributes <= MAX_ATTRIBUTESUnknown attribute %s for tag %s Attribute value %s ignored Unknown entity %s End Start <%s> %d&#`<%s/' found! `<%s!' found! *** Unknown element %s found = but no value Unknown end tag `ARTICLEmessage/rfc822text/plainLISTtext/x-nntp-listGROUP%d%d%d%d-%dXOVERtext/x-nntp-overtext/x-nntp-headHEADNewsgroups: Newsgroup: news:HTNewsCache_newHTNewsLs.cNews Cache.. Deleted cache %p nntp:w3c-newsNews Cache.. No information for `%s' /News Cache.. Can't create tree News Cache.. AFTER filter News Dir.... Line too long - chopped News Dir.... ABORTING... t`@HxdNewsListHTNewsList_newFrom: %s%c%cNewsgroups :newsnntpNews Tx..... %sNewsPost.... ABORTING... u xNewsPostNewsPost_newHTNewsRq.cHTNewsNode_newHTNDir.cre: by (%d groups)HTNewsDir_newtext/htmlNews ListingHTNewsNode_setGroupInfo.*NewsListing. Invalid sortkey *Template.... Made template `%s' for file `%s' HTBasic_newHTAABrow.cbasic_credentials:Basic Basic Cookie `%s' Proxy-AuthorizationAuthorizationbasicrealmBasic Parse. Realm `%s' found Basic Parse. Proxy authentication Auth........ No challenges found HTDigest_newDigest Update.. Processing authentication-info authentication-infoproxy-authentication-infoDigest Update.. Didn't find any authentication-info digestDigest Update.. Error: received authentication-info without having a local digest nextnonceqoprspauthcnoncenc,="md5-sessauth-int%08lxusernamenonceuriauthmd5responseopaquedigest_credentialsDigest Digest Cookie `%s' 012345678Digest Parse. Realm `%s' found Digest Parse. Proxy authentication Digest Parse. Missing or incomplete realm domainstaletruealgorithmDigest Parse Unknown algorithm `%s' Digest Parse Proxy authentication Auth Engine. Bad argument HTAA_newModuleHTAAUtil.cAuth Engine. Created module %p Auth Engine. Found module %p Auth Engine. did %sfind %s NOT Auth Engine. Bad augument Auth Engine. deleted %p HTAAElement_newAuth Engine. Created element %p Auth Engine. Deleted element %p Auth Engine. Looking up `%s' w3c-proxy-AAw3c-AAAuth Engine. No information Auth Engine. Adding info for `%s' Auth Engine. Module `%s' not registered Auth Engine. Can't create tree Auth Engine. Deleting info for `%s' Auth Engine. Found BEFORE filter %p Auth Engine. After filter status %d basicrealm LIBWWW-UNKNOWNAuth Engine. Found AFTER filter %p Auth Engine. Update filter status %d Auth Engine. Found Update filter %p Auth Engine. Found Proxy BEFORE filter %p with context %p Chunked..... `%s' chunk size: %X HTTChunk.cChunk decoder received illigal chunk size: `%s' message/x-rfc822-foot*/*Chunked..... FREEING.... Chunked..... ABORTING... ~یڤ8ChunkDecoderHTChunkDecoderChunked..... Decoder stream created %c%c%x %s %c%c%x %s %c%c%c%c%x%c%c%x%c%cChunked..... chunk size 0x%X Xބޤd@ܐChunkEncoderHTChunkEncoderChunked..... Encoder stream created HTTP Clean.. Called with status %d, net %p HTTPInformationHTTPNextStatehttpHTTPStatusStreamwww/unknownHTTP Status. `%s' is probably a broken 1.0 server that doesn't understand HEAD HTTP Status. Major version number is %d HTTP Status. This is a *BROKEN* HTTP/1.0 server HTTP Status. This is an HTTP/1.0 server HTTP........ Mode is HTTP/1.1 with NO PIPELINING HTTP........ Mode is HTTP/1.1 with MUXING HTTP........ Mode is FORCE HTTP/1.0 message/x-rfc822-contmessage/x-rfc822-upgrademessage/rfc822message/x-rfc822-headmessage/x-rfc822-partialHTTPStatus.. ABORTING... P0P8HTTPStatusHTTPStatus_newHTTP.cHTTP........ Looking for `%s' HTLoadHTTPHTTP timer %p not in sync Uploading... Flushing %p with timer %p Uploading... Callback returned %d closeKeep-AliveHTTP........ Mode is HTTP/1.1 WITH NO PIPELINING HTTP........ Force flush on preemptive load text/x-httpw3chttp.outabHTTP........ Dumping response to `%s' HTTP........ Dumping request to `%s' Uploading... Holding %p for %lu ms using time %p HTTP........ Continuing Bad http state %d GET HTTP........ Generating HTTP/0.9 Request /HTTP/1.0HTTP/1.1www/presentAccept: ;q=%1.1fwww/*Accept-Charset: Accept-Encoding: TE: chunkedtrailersAccept-Language: : Expect: =From: Host: If-Range: "HTTP........ If-Range using etag `%s' If-Match: *HTTP........ If-Match using `*' If-Match: "HTTP........ If-Match using etag `%s' If-Unmodified-Since: HTTP........ If-Unmodified-Since `%s' If-None-Match: *HTTP........ If-None-Match using `*' If-None-Match: "HTTP........ If-None-Match `%s' If-Modified-Since: HTTP........ If-Modified-Since `%s' %dMax-Forwards: Range: Referer: User-Agent: HTTP........ Generating HTTP/1.x Request Headers ?HTTPRequest. ABORTING... (`|HTTPRequestHTTPRequest_newHTTPReq.c100-continuePEP Engine.. Bad argument find_moduleHTPEP.cHTPEP_newModulePEP Engine.. Created module %p PEP Engine.. Found module %p PEP Engine.. did %sfind %s NOT PEP Engine.. Bad augument PEP Engine.. deleted %p HTPEPElement_newPEP Engine.. Created element %p PEP Engine.. Deleted element %p PEP Engine.. Created list %p PEP Engine.. Deleted list %p PEP Engine.. Looking for info on `%s' w3c-pepPEP Engine.. No information PEP Engine.. Adding info for `%s' PEP Engine.. Module `%s' not registered PEP Engine.. Can't create tree PEP Engine.. Calling BEFORE protocols %p PEP Engine.. Calling AFTER protocols %p Cache-Control: =Connection: Date: %s%c%cPragma: %s%c%cno-cacheMessage-ID: %s%c%cMIME-Version: %s%c%cMIME/1.0: HTTPGen..... Extra local HTTPGen..... Extra global %c%cHTTP........ Generating General Headers HTTPGen..... ABORTING... +,0,+++THTTPGenHTTPGen_newHTTPGen.ccloseKeep-AliveTEBoundary.... `%s' found Boundary.... Ending message/rfc822Boundary.... FREEING.... Boundary.... ABORTING... x112@11d-HTBoundaryboundaryHTBound.cBoundary.... Stream created with boundary '%s' Boundary.... UNKNOWN boundary! www/unknownMIME Parser. BAD - there seems to be a body but no length. This must be an HTTP/1.0 server pretending that it is HTTP/1.1 MIME Parser. No body in this message Building.... C-T stack from %s to %s Building.... Content-Decoding stack www/cache-appendwww/cacheBuilding.... Transfer-Decoding stack MIME header. %s: %s MIME........ FREEING.... MIME........ ABORTING... AxABPA4AT;MIMEParserHTMIMEConvertHTMIME.cCache Load.. loading partial cache entry Cache Flush. Flushing and freeing PIPE buffer */*Partial..... Starting cache load HTMIMEParseElHTMIMPrs.ctokenHTMIMEParseSetHTMIME parsersAllow: binaryidentity7bit8bitContent-Encoding: Content-Transfer-Encoding: %s%c%cContent-Language: Content-Length: %ld%c%cTransfer-Encoding: %s%c%cchunkedwww/unknownapplication/octet-streamContent-Type: ;=Derived-From: %s%c%cExpires: %s%c%cLast-Modified: %s%c%cLink: "";rel="%s", "Title: %s%c%cContent-Version: %s%c%c%c%cBuilding.... Transfer-Encoding stack MIME........ Generating Entity Headers httpMIMERequest. ABORTING... VWX WWVTMIMERequestHTMIMERequest_newHTMIMERq.cdigestcloseMIMEParser.. Close received... keep-aliveMIMEParser.. HTTP/1.0 Keep Alive MIMEParser.. HTTP/1.0 Keep Alive ignored maxMIMEParser.. Max %d requests pr connection timeoutMIMEParser.. Timeout after %d secs relMIMEParser.. Link forward relationship `%s' revMIMEParser.. Link reverse relationship `%s' typeMIMEParser.. Link type `%s' www/unknownMIMEParser.. Link unknown `%s' with value `%s' Digest-MessageDigestno-cacheMIMEParser.. No-Cache Pragma Protocol.... Name: `%s', value: `%s' Protocol.... Info: `%s', value: `%s' Protocol.... Request: `%s', value: `%s' MIMEParser.. Public methods: %d HTMIME_warningMIMEParser.. Invalid warning text/voidimage/voidaudio/voidvideo/voidapplication/x-gopher-indexapplication/x-gopher-csoapplication/x-gopher-telnetapplication/x-gopher-tn3270application/x-gopher-duplicatewww/unknownapplication/octet-streamCSO Search GopherMenufor HTGopher.... Menu line: `%s' error.hosterrorhostGopherMenuLineHTGopher.ctelnet://%s@%s/telnet://%s/tn3270://%s@%s/tn3270://%s///%s/%c%s//%s/%cHTGopher.... Bad menu item, `%s' Empty valueGopher...... Line too long - ignored Gopher...... ABORTING... prrsrrdq GopherMenu_newtext/htmlSearchable Gopher IndexSearchable SCO IndexSearchable Index of a CSO Name ServerA CSO Name Server usually provides directory information about people.Gopher...... Looking for `%s' HTLoadGopher query gopherGopher Tx... `%s'%d%cFTP Rx...... `%s' alreadyFTP Status.. Line too long - chopped FTPStatus... ABORTING... Tt4FTPStatusFTPStatus_newHTFTP.c%s %s%c%c%s%c%cFTP Tx...... %sanonymouslibwww@FTPParse.... uid `%s' pw `%s' ;type=FTPParse.... Datatype %c getsocknameFTP......... This host is `%s' %d,%d,%d,%d,%d,%dFTP Login.. now in state NEED_SELECT FTP Login.. now in state NEED_GREETING FTP Login.. now in state NEED_REIN REINFTP Login.. now in state NEED_UID USERFTP Login.. Already logged in FTP Login.. User Unknown FTP Login.. now in state NEED_PASSWD PASSFTP Login.. now in state NEED_ACCOUNT ACCTFTP Login.. now in state PROMPT_USER FTP Login.. now in state SUB_ERROR HTFTPLoginFTP......... Login failed FTP Login.. now in state SUB_SUCCESS FTP......... Logged in as `%s' FTP Data.... now in state NEED_TYPE TYPEFTP Data.... now in state NEED_SELECT FTP Data.... now in state NEED_PASV PASVFTP Data.... PASV No addr ftp://%d.%d.%d.%d:%d/FTP Data.... now in state NEED_PORT PORTFTP Data.... now in state SUB_ERROR FTP Data.... Can't setup data connection FTP Data.... now in state SUB_SUCCESS FTP Data.... Data connection negotiated FTP Server.. now in state NEED_SYST SYSTFTP Server.. now in state CHECK_SYST FTP Server.. No server info? UNIX Type: L8MAC-OSMachTenUNIXVMSVM/CMSVMDCTSMAC-OS TCP/ConnectIIMACOS Peter's ServerWindows_NTFTP Server.. now in state NEED_PWD PWDFTP Server.. now in state CHECK_PWD FTP Server.. No current directory? FTP Server.. now in state SUB_ERROR FTP Server.. Can't get server information FTP Server.. now in state SUB_SUCCESS FTP Server.. Guessed type %d FTP Get Data now in state NEED_SELECT FTP Get Data now in state NEED_CONNECT FTP Get Data.... Active data socket %d FTP Get Data Swap to PORT on the fly FTP Get Data now in state NEED_ACCEPT FTP Get Data.... Passive data socket %d FTP Get Data now in state NEED_ACTION NLSTRETRLISTFTP Get Data no such file or directory FTP Get Data now in state NEED_SEGMENT segment [%s]/FTP Get Data now in state NEED_CWD CWDFTP Get Data now in state NEED_STREAM FTP Get Data now in state NEED_BODY FTP Get Data now in state SUB_ERROR HTFTPGetDataFTP Get Data now in state SUB_SUCCESS FTP......... Looking for `%s' HTLoadFTPHTLoadHTTPFTP Event... now in state FTP_BEGIN FTP Event... This module only supports the GET method FTP Event... Transfer mode set to '%c' FTP Event... now in state FTP_NEED_CONN ftpHTLoadNewsFTP Server.. Cache says type %d server FTP Event... now in state FTP_NEED_LOGIN FTP Event... now in state FTP_NEED_DCON FTP Event... now in state FTP_NEED_DATA FTP Event... now in state FTP_NEED_SERVER FTP Event... now in state FTP_SUCCESS FTP Event... now in state FTP_ERROR - -> .Z_Z.dirtotal not availableFTP Dir..... Line too long - ignored FTPDir...... ABORTING... 08\FTPDirHTFTPDirHTFTPDir.caiapplication/postscript8bitaifaudio/x-aiffbinaryaifcaiffauaudio/basicasfvideo/x-ms-asfavivideo/x-msvideobatapplication/octet-streambcpioapplication/x-bcpiobinbmpimage/bmpctext/plain7bitcccppcdfapplication/x-netcdfcgmimage/cgmconfapplication/x-www-rulescpioapplication/x-cpiocshapplication/x-cshcsstext/cssdlldocapplication/msworddotdviapplication/x-dviepsetxtext/x-setextexef90gifimage/gifhhdfapplication/x-hdfhhhtmtext/htmlhtmliefimage/iefjpeimage/jpegjpegjpglatextext/latexmmanapplication/x-troff-manmeapplication/x-troff-memhtmessage/rfc822mhtmlmimemovvideo/quicktimemovievideo/x-sgi-moviempevideo/mpegmpegmpgmsapplication/x-troff-msncodaapplication/odapbmimage/x-portable-bitmappcuapplication/x-pics-userpdfapplication/pdfpgmimage/x-portable-graymappgpapplication/pgp-encryptedpngimage/pngpnmimage/x-portable-anymappptapplication/vnd.ms-powerpointpsqtrasimage/cmu-rasterrgbimage/x-rgbroffapplication/x-troffrtftext/rtfrtxtext/richtextshapplication/x-shsigapplication/pgp-signaturesharapplication/x-sharsndsrcapplication/x-wais-sourcesv4cpioapplication/x-sv4cpiosv4crcapplication/x-sv4crcttarapplication/tarapplication/x-tartclapplication/x-tcltextext/textexiapplication/x-texinfotifimage/tifftifftrtsvtext/tab-separated-valuestxtustarapplication/x-ustarwavaudio/x-wavxbmimage/x-xbitmapxlsapplication/vnd.ms-excelxmlapplication/xmlxpmimage/x-xpixmapxwdimage/x-xwindowdumpzipapplication/zipZcompressgzgzip*.*www/unknown***.*HTBind_initHTBind.c.,_www/unknownbinaryHTBind_addAnchor...... Get bindings for `%s' Response.... Get Bindings for `%s' Get Binding. Look for '%s' Found! Not found - use default for '*.*' Get Binding. No suffix found - using default '%s' Get Binding. Result for '%s' is: type='%s', encoding='%s', cte='%s', language='%s' with quality %.2f unknown>Ey0:Reading..... directory HTFile_readDir/.www_browsableRead dir.... `%s' not found ...Read dir.... lstat failed: %s -opendirFile mode is 0%o, uid=%d, gid=%d. My uid=%d, %d groups ( %d) File is not editable. HTLoadFile.. Looking for `%s' HTLoadFILEHTFile.cFile timer %p not in sync HTLoadFile.. Continuing %p with timer %p HTLoadFileLoadFile.... No access to local file system localhostHTLoadFile.. Pending... Load File... Found `%s' Load File... Not found - even tried content negotiation Load File... Not found `%s' HTLoadFile.. Returning ftp:file:??7bit8bitbinary?Ranking..... No variants Qualities... Content type: %.3f, Content language: %.3f, Content encoding: %.3f Ranking..... RANK QUALITY CONTENT-TYPE LANGUAGE ENCODING FILE %d. %.4f %-20.20s %-8.8s %-10.10s %s -.multiWarning..... Can't open directory %s ....www_browsabledir_matchesHTMulti.c%s/%sNo matches.. for "%s" Multi....... Possibilities for "%s" QUALITY CONTENT-TYPE LANGUAGE ENCODING FILE %.4f %-20.20s %-8.8s %-10.10s %s - Multi....... `%s' is not readable Welcome.htmlwelcome.htmlindex.htmlget_best_welcome%s%s%s/Welcome..... "%s" Multi....... by %s suffix Multi....... failed -- giving up AutoMulti... can't stat "%s"(errno %d) AutoMulti... failed -- giving up Stat fails.. on "%s" -- giving up (errno %d) prefixedHTIcons.c/HTIcon_alt_stringHTAddIconAddIcon..... %s => SRC="%s" ALT="%s" HTAddUnknownIconIcon add.... UNKNOWN => SRC="%s" ALT="%s" HTAddBlankIconIcon add.... BLANK => SRC="%s" ALT="%s" Icon add.... PARENT => SRC="%s" ALT="%s" Icon add.... DIRECTORY => SRC="%s" ALT="%s" HTDirNode_newHTDir.c/HTDirNode_print NameLast ModifiedSizeDescriptionHTDir_newtext/htmlHTDir_new... base is `%s' Current index is Index of HTDir_addElementEmpty directory1 File%u filesCache....... Garbage collecting Cache....... Collecting Stale entries Cache....... Collecting least used entries Cache....... Collecting entries with %d hits Cache....... Size reduced from %ld to %ld cache_index_nameHTCache.c.indexCache Index. Writing index `%s' wbCache Index. Can't open `%s' for writing %s %s %s %ld %ld %ld %c %d %d %ld %ld %ld %c @w3c@Cache Index. Error writing cache index HTCacheIndex_parseLine%ld %ld %ld %c %d %d %ld %ld %ld %cCache Index. Error reading cache index HTCache_parseLineCache Index. FREEING.... Cache Index. ABORTING... 0  H    CacheIndexParserHTCacheIndexscache:*/*www/cache-indexCache....... Creating dir `%s' Cache....... can't create Cache....... dir `%s' already exists file:/WWW_CACHETMPTEMP/tmp/w3c-cache/Cache Root.. Local root set to `%s' HTCache_getLock.lockrCache....... In `%s' is already in use wCache....... Can't open `%s' for writing HTCache_deleteLockhttp://*Cache....... Total cache size: %ld with %ld bytes for metainformation and folders and at least %ld bytes free after every gc Cache...... Max entry cache size is %ld Cache...... Max entry cache size is unchanged Cache....... delete %p from list %p HTCache_createLocation%s%dCache....... Create dir `%s' Cache....... Can't create... Cache....... Directory `%s' already exists calculate_timeCache....... Received Age %d, corrected %d, freshness lifetime %d Cache....... Bad argument HTCache_newCache....... Entry %p already in use Cache....... Can't get a cache object Cachefilter. Checking persistent cache Cachefilter. We only check GET methods no-cachemax-age0only-if-cachedDisconnected Cache ModeHTCacheFilterCache....... Merging metainformation Cache....... Total size %ld Cache....... Found %p hits %d HTCache_metaLocation%s%s.metaconnectionkeep-aliveproxy-authenticateproxy-authorizationtransfer-encodingupgrade%s: %s Cache....... Error writing metainfo Cache....... Invalid cache entry Cache....... Meta information loaded Cache....... Target ERROR %d Cache....... Invalid meta name Cache....... Looking for `%s' rbCache....... Can't open `%s' for reading message/x-rfc822-headwww/debug%ld-Cache....... Asking for range `%s' bytesmax-stalemin-freshCache....... Max-age validation Cache....... Min-fresh validation Cache....... Locking cache entry %p Cache....... Unlocking cache entry %p Cache....... Breaking lock on entry %p Cache....... Hits for %p is %d Cache....... ABORTING 1,00111PCacheCache....... Not enabled Cache....... won't cache protected objects Cache....... Entry is too big - won't cache Cache....... Entry already in use abCache....... %s file `%s' Append toCreatingLoad Cache.. Looking for `%s' HTLoadCACHEFile timer %p not in sync HTLoadCache. Continuing %p with timer %p HTLoadCacheLoad Cache.. No access to local file system cacheHTLoadCache. Pending... Load Cache.. Not found `%s' HTLoadCache. Returning append_bufHTConLen.cBuffer...... size %d reached, going transparent buf_put_charBuffer...... created with len %d Buffer....... Paused PipeBuffer Waiting to be flushed Buffer........ Calculated content-length: %d Buffer...... ABORTING... BufferHTBufferStreamBuffer...... Created with size %d Save File.. ABORTING... ɈAB@BAABFileSaveHTFileSave_newHTFSave.c/indexSave file... Temporaray file `%s' HTSaveLocallySave File... turned off wbSave File... No file name - error stream Save File... No file name - black hole Save File... turned offHTSaveAndExecuteSave File... No file name SaveAndExecuteFileWriter.. ABORTING... (IJJ`IDIpIFileWriterFileWriter.. Bad file descriptor HTFWriter_newHTFWrite.c�����GUESSING.... Result of content analysis: Text=%d%% Newlines=%d%% Ctrl=%d%% High=%d%% ���8bit����7bit����text/html�������%!������application/postscript��#define�_width��_bits���image/x-xbitmap�converted with BinHex���macbinhex�������begin ��base64��text/plain������GIF�����image/gif�����������image/jpeg������MM������image/tiff������PNG  ��������image/png�������.snd����audio/basic�����������compress��������������gzip����application/octet-stream��������www/unknown�����GUESSING.... Hmm - trying local bindings �������GUESSING.... That's it - I'm giving up! ��������Guessed..... Content-Type `%s' �HTGuess..... Can't convert media type ��?�������p�LD�S�T�Sh�S�Q����GuessWhat�������HTGuess_new�����HTGuess.c�������Merge Free.. Called with %d feeds ������Merge Abort. Called with %d feeds ����Ud�U�V �T�T�U(MergeStream�����HTMerge�HTMerge.c�������Merge....... Created stream %p �Chunkstream. FREEING... ��������Chunkstream. ABORTING... �������StreamToChunk���HTStreamToChunk�HTSChunk.c������ChunkStream. Chunk %p created with max size %d ���Z�[ �[�Y�Z�Zh����Tee�����HTTee���HTTee.c�Tee......... Created stream %p with resolver %p ��������HTBufWrt.c������Buffer Writer timer %p not in sync �����Buffer...... Timeout flushing %p with timer %p �Buffer...... Flushing %p �������Buffer...... Waiting %dms on %p ��������Buffer...... Dispatching old timer %p ��Buffer...... Waiting on unexpired timer %p �����Buffer...... Increasing buffer to %d bytes �����HTBufferWriter_addBuffer��������Buffer...... ABORTING... �����]�_ �`�a�a�`�b����BufferedSocketWriter����Socket...... Could not get TCP send buffer size for socket %d ��Socket...... TCP send buffer size is %d for socket %d ��HTBufferWriter_new������open����HTFileOpen.. `%s' opened %d as %sblocking socket ���������������NON-����Closing..... fd %d �����Read Socket. No read stream for net object %p ��Read Socket. WOULD BLOCK fd %d �Read Socket. got EPIPE �Read Socket. got ECONNRESET ����NETREAD�Read Socket. FIN received on socket %d �Reading from socket %d��Read Socket. %d bytes read from socket %d ������Read Socket. Target WOULD BLOCK ��������Read Socket. Target PAUSED �����Read Socket. CONTINUE ��Read Socket. Target returns %d �Read Socket. Target ERROR %d ���Read Socket. DIDN'T CONSUME %d BYTES: `%s' �����Socket read. FREEING.... �����f�f`�f�f�j�kDSocketReader����HTReader_new����HTReader.c������Reader...... Created reader stream %p ��Write Socket No Net object %d (offset %d) ������Write Socket WOULD BLOCK %d (offset %d) ��������Write Socket call interruted - try again �������Write Socket got EPIPE �NETWRITE��������Writing to socket %d����Write Socket %d bytes written to %d ����Socket write FREEING.... ����֠�l�l�l$�nD�nd�l,�n����SocketWriter����HTWriter_new����HTWriter.c������Alert Call.. Add Alert Handler %p ������HTAlertCall_add�HTAlert.c�������Alert Call.. Delete Alert Handler %p ��Alert Call.. Delete all handlers with opcode %d ��������Alert Call.. Delete All callback functions �����Alert Call.. No entry found for opcode %d ������HTAlert_newReply��������HTParentAnchor_new������HTAnchor.c������www/unknown�����HTChildAnchor_new�������Child Anchor Bad argument ������HTAnchor_findChild������Child Anchor %p of parent %p with name `%s' already exists. ����Child Anchor New Anchor %p named `%s' is child of %p �����������HTAnchor_findAddress����Find Parent. %p with address `%s' already exists. ������Find Parent. %p with hash %d and address `%s' created ��AnchorDelete No anchor found ���AnchorDelete Remove parent %p and children �����Anchor...... Not deleted �������Anchor...... Can't add object %p to array %p ���HTAnchor_address��������%s#%s���HTAnchor.... setPhysical, called with null argument ����HTAnchor.... Updating etag for %p ������HTAnchor.... Information is up to date for %p ��HTAnchor.... Updating metainformation for %p ���date����content-base����content-location��������robots��charset�level���content-language��������allow���title���version�derived-from����content-md5�����expires�last-modified���age�����etag����W/������HTAnchor.... Anchor is parsed ��HTAnchor.... Clear all header information �������8���8�p�������ChannelInput�����h�P����8�p�ChannelOutput���Channel..... Deleted %p, socket %d �����Channel..... Deleted %p, file %p �������Channel..... Hash value is %d ��HTChannel_new���HTChannl.c������Channel..... Added %p to list %p �������Channel..... Delete %p with semaphore %d �������Channel..... Semaphore increased to %d for channel %p ��Channel..... Semaphore decreased to %d for channel %p ��Channel..... Semaphore set to %d for channel %p ��������HTError_add�����HTError.c�������HTErrorError����Error....... Add %3d Severity: %d Parameter: `%s' Where: `%s' ��Unspecified�����unknown�Error....... Delete %p �Error....... Ignore %p �Severity.... Found a severe error ������0123456789ABCDEF��������HTEscape��������HTEscape.c������HTUnEscape.. Called with NULL argument. ��������Event....... registering %p ����Event....... No handler registered �����HTEvent_new�����HTEvent.c�������Event....... Created event %p with context %p, priority %d, and timeout %d �����Event....... Deleted event %p ��HTEvent_RESET���HTEvent_FLUSH���HTEvent_END�����HTEvent_BEGIN���HTEvent_TIMEOUT�HTEvent_OOB�����HTEvent_CONNECT�HTEvent_WRITE���HTEvent_CLOSE���HTEvent_ACCEPT��HTEvent_READ����0x%x�������(�0�8��� ����BlackHoleConverter������BlackHole... Converter Created �HTSetPresentation�������HTFormat.c������www/present�����Presentation Adding `%s' with quality %.2f �����Conversions. Adding %p with quality %.2f �������HTCoding_add����Codings..... Adding %s with quality %.2f �������Codings..... Bad argument ��������������Languages... Bad argument ������HTAcceptLanguage��������Charset..... Bad argument ������HTAcceptCharsetuage�����www/void��������StreamStack. Raw output... �����StreamStack. Identical input/output format (%s) ��������StreamStack. Constructing stream stack for %s to %s ����<NULL>��*/*�����StreamStack. Source output �����StreamStack. NOT FOUND - error! ��������StackValue.. Evaluating stream stack for %s worth %.3f to %s �����������)>Y9Codings... Nothing applied... ��C-E......... Looking for `%s' ��C-E......... Found `%s' ��������binary��identity��������7bit����8bit����C-E......... NOT FOUND - can't encode stream! ��C-E......... NOT FOUND - error! ��������C-E......... Found... ��C-T-E..... Nothing applied... ��C-T-E....... Looking for %s ����C-T-E....... Found... ��C-T-E....... NOT FOUND - removing encoding! ����C-T-E....... NOT FOUND - error! ��������Host info... object %p from list %p ����Host kill... Pipeline due to %s event ��Host kill... Terminating net object %p from pending queue ������Host kill... Terminating net object %p from pipe line ��Host Event.. wild socket %d type = %s real socket is %d ��������Event_Close�����Event_Read������Host Event.. READ passed to `%s' �������HostEvent... Error: %d bytes left to read and nowhere to put them ������Host Event.. host %p `%s' closed connection. ���Host Event.. Host %p `%s' had %d extraneous bytes: `%s' ��������Host Event.. WRITE passed to `%s' ������Host Event Host %p (`%s') dispatched with event %s but doesn't have a target - %d requests made, %d requests in pipe, %d pending �������<null>��Don't know how to handle OOB data from `%s'? ���Host info... Bad argument ������HTHost_find�����HTHost.c��������Host info... Collecting host info %p ���Host info... Persistent channel %p gotten cold �Host info... REUSING CHANNEL %p ��������Host info... Found Host %p with no active channel ������HTHost_add������Host info... added `%s' with host %p to list %p ����������������HTHost_newWParse��������HTHost parse Looking up `%s' on port %u ��������HTHost parse Can't get host info �������Host info... Looking for `%s' ��Host info... Collecting host %p ��������Host info... Found `%s' ��������bytes���Host info... added host %p as persistent �������Host info... no room for persistent socket %d ��Host info... %p already persistent �����Host info... removed host %p as persistent �����Host has %d object(s) pending - attempting launch ������Host recovered %d times. Moving %d Net objects from pipe line to pending queue �Host recover Resetting net object %p ���Host info... Moving %d Net objects from pipe line to pending queue �����Host info... Resetting net object %p ���Host info... %p is bad for pipelining so we won't do it!!! �����Host info... New mode is %d for host %p ��������Host info... Added Net %p (request %p) as pending on pending Host %p, %d requests made, %d requests in pipe, %d pending ��������Host info... Added Net %p (request %p) to pipe on Host %p, %d requests made, %d requests in pipe, %d pending ���Host info... Added Net %p (request %p) as pending on Host %p, %d requests made, %d requests in pipe, %d pending ��������Host Object. got close notifiation on socket %d ��������%d requests made, %d in pipe, max %d requests pr connection ����Host Object. closing persistent socket %d ������Host Object. keeping persistent socket %d ������Host Event.. Channel unexpected deleted from host %p (%s) ������Host........ Object %p going idle... ���Host Object. closing socket %d �Host info... Remove %p from pipe �������Host info... Popping %p from pending net queue on host %p ������Host info... Popping %p from pending host queue ��������Host info... Bad arguments �����Launch pending net object %p with %d reqs in pipe (%d reqs made) �������Launch pending host object %p, net %p with %d reqs in pipe (%d reqs made) ������Host connect Grabbing lock on Host %p with %p ��Host connect Changing lock on Host %p to %p ����Host connect Unlocking Host %p �Host connect Host %p already locked with %p ����Listen...... On Host %p resulted in %d �HTHost req.. Bad arguments �����Host........ %d bytes remaining �������Host........ Emtied out connection �����Host Object. Can't create input stream �Host Object. Can't create output stream ��������Host........ passing %d bytes as consumed to %p ��������Host........ Default write delay is %d ms ������Host Event.. FLUSH passed to `%s' ������Host........ Setting event timeout to %d ms ����HTHost...... Registering %p ����HTHost...... No ActivateRequest callback handler registered ����System Error %d after call to %s() failed ............ %s ������%d.%d.%d.%d�����ParseInet... as port %d on %s with %d homes ����HostName.... sysinfo says `%s' �HostName.... gethostname says `%s' �����/etc/resolv.conf��������r�������domain��search��.�������HostName.... Can't get domain name �������������HostName.... FQDN is `%s' ������MailAddress. getlogin returns NULL �����LOGNAME�MailAddress. LOGNAME not found �USER����MailAddress. USER not found ����libwww��@�������NNTPSERVER������/usr/local/lib/rn/server��������news����TimeZone.... GMT + (%02d) hours (including DST) ��������libwww��5.2.8���UNKNOWN�0.0�����WWWLibInit.. INITIALIZING LIBRARY OF COMMON CODE �������TMPDIR=�LIBWWW_GENERIC_USER�����WWWLibTerm.. Cleaning up LIBRARY OF COMMON CODE ��������HTLink_new������HTLink.c��������Link create. from anchor %p to %p with type %s, method %s ������NONE����Link........ Bad argument ������Link delete. from anchor %p to anchor %p �������Link delete. from anchor %p ����Link move... all from anchor %p to anchor %p ���UNLINK��LINK����OPTIONS�TRACE���DELETE��PATCH���PUT�����POST����HEAD����GET�����INVALID-METHOD��HTNetCall_addBefore�����HTNet.c�Net Before.. Add %p with order %d tmplate `%s' context %p ������<null>��Net Before.. Delete %p �Net Before. Delete All filters �Net Before.. calling %p (request %p, context %p) �������HTNetCall_addAfter������Net After... Add %p with order %d tmplate `%s' code %d context %p ������Net After... Delete %p �Net After... Delete all with status %d �Net After. Delete All filters ��Net After... calling %p (request %p, response %p, status %d, context %p) �������Net Manager. Increasing active sockets to %d, %d persistent sockets ����Net Manager. Decreasing active sockets to %d, %d persistent sockets ����Net Manager. %d active sockets, increasing persistent sockets to %d ����Net Manager. %d active sockets, decreasing persistent sockets to %d ����Net timer. %p not in sync ������HTNet....... Continuing calling AFTER filters %p with timer %p �createAfterFilterEvent��HTNet_new�������create_object���Net Object.. %p created with hash %d ���Net Object.. Duplicated %p �����Net Object.. %p calling %p with event type %d and context %p ���Net Object.. Launching %p ������Net Object.. Using default address �������������Net Object.. NO PROTOCOL Object found for URI scheme `%s' ������Net Object.. NO SERVER HANDLER for URI scheme `%s' �����Net Object.. NO TRANSPORT found for protocol `%s' ������Net Object.. starting SERVER request %p and net object %p ������Net Object.. NO CLIENT HANDLER for URI scheme `%s' �����Net Object.. starting request %p (retry=%d) with net object %p �Net Object.. Check for pending Net objects �����Net Object.. Freeing object %p �Net Object.. Delete %p and call AFTER filters ��Net Object.. Restarting request %p (retry=%d) with net object %p �������Net Object.. Remove all Net objects, NO filters ��������Net Object.. Killing %p ��������Net Object.. No object to kill �Net Object.. Kill ALL Net objects!!! ���Net Object.. No objects to kill ��������Net Object.. Persistent connection set %s %s ���ON������OFF�����succeeded�������failed��Host Object.. Can't create output stream �������URL�������������parse space�����HTParse.c�������:�������//������/�������#�������http����gopher��ftp�����HTSimplify.. Nothing done ������HTSimplify.. `%s' ������://�����:/������news:���into ............ `%s' �/../����HTRelative������./������../�����HTRelative.. `%s' expressed relative to `%s' is `%s' ��Illegal..... character in URL: "%s" ����Truncated... "%s" ������HTProtocol_add��HTProt.c��������Protocol.... Adding `%s' �������HTProtocol_find�HTRequest_new()�HTReqMan.c������www/present�����www/debug�������Request..... Created %p ��������HTRequest_dup���Request..... Duplicated %p to %p �������Request..... Delete %p �Request..... Deleting dangling output stream ���Request..... Deleting dangling debug stream ����POSTWeb..... Adding dest %p to src %p ��POSTWeb..... Deleting dest %p from src %p ������POSTWeb..... terminated ��������POSTWeb..... All destinations are ready! �������POSTWeb..... Linking dest %p to src %p �POSTWeb..... All destinations ready! ���POSTWeb..... Unlinking dest %p from src %p �����POSTWeb..... Killing ���Load Start.. Bad argument ������Serve Start. Bad argument ������HTResponse_new()��������HTResponse.c����www/unknown�����Response.... Created %p ��������Response.... Delete %p �no-store��������no-cache��������max-age�must-revalidate�etag����charset�� X�_�_�_�_�_�_����BlackHole���� �`4�`<�`D�`�`$�`,ErrorStream�����socket��Socket...... Created %d ��������Socket...... Could not disable Nagle's algorithm - error %d ����Socket...... Turned off Nagle's algorithm ������Socket...... %slocking socket ��B�������Non-b���Socket...... Blocking socket ���HTDoConnect. Pending... ��������HTHost %p going to state TCP_CHANNEL. ��HTHost %p going to state TCP_DNS. ������HTHost %p going to state TCP_CONNECTED. ��������HTDoConnect. Can't locate `%s' �HTDoConnect�����HTHost %p going to state TCP_ERROR. ����HTHost %p going to state TCP_NEED_SOCKET. ������HTHost %p going to state TCP_NEED_CONNECT. �����HTDoConnect. WOULD BLOCK `%s' ��HTHost %p connected. ���HTHost %p going to state TCP_BEGIN. ����connect�HTDoAccept.. Invalid socket ����HTDoAccept.. WOULD BLOCK %d ����accept��HTDoAccept.. Accept failed �����Accepted.... socket %d �HTDoListen.. Pending... ��������HTHost %p going to state TCP_SOCKET. ���HTHost %p going to state TCP_NEED_BIND �Socket...... Binding socket %d �Socket...... Bind failed %d ����Socket...... Starting listening on socket %d ���HTHost %p listening. ���HTDoClose... Close %d ��HTDoClose... No pending requests �������Timer....... Dispatch timer %p �Timer....... registering %p as timer set cbf ���Timer....... registering %p as timer delete cbf ��������Timer....... Deleted active timer %p ���Timer....... Deleted expired timer %p ��HTTimer.c�������Timer %p not found �����Timer....... Found timer %p with callback %p, context %p, and %s timeout %d ����relative��������absolute��������HTTimer_new�����Timer....... Created %s timer %p with callback %p, context %p, and %s timeout %d �������repetitive������one shot��������Timer....... Timeout is 0 - expires NOW ��������HTTransport_add�HTTrans.c�������Transport... Adding `%s' �������Transport... Can't add this... �HTTransport_find��������HTURealm_new����HTUTree.c�������URL Node.... Realm `%s' found ��HTUTemplate_new�URL Node.... Found template `%s' for for `%s' ��URL Node.... Not found �URL Node.... At least realm must be present ����URL Tree.... Bad argument ������HTUTree_find����URL Tree.... Collecting URL Tree %p ����HTUTree_new�����URL Tree.... Created %p with name `%s' �URL Tree.... Found %p with name `%s' ���URL Tree.... did %sfind `%s' �����������NOT ����URL Tree.... Bad augument ������URL Tree.... deleted %p ��������HTUserProfile_new�������HTUser.c��������User Profile Adding `%s' �������User Profile Localizing %p �����/tmp/���/�������Dec�����Nov�����Oct�����Sep�����Aug�����Jul�����Jun�����May�����Apr�����Mar�����Feb�����Jan�����MessageID... Can't make a unique MessageID ������������<%ldZ%ld@%s>����@@@�����Format...... Weekday, 00-Mon-00 00:00:00 GMT ���ERROR....... Not a valid time format "%s" ������Format...... Wkd, 00 Mon 0000 00:00:00 GMT �����Format...... YYYY.MM.DDThh:mmStzWkd ����ERROR....... Not a valid time format `%s' ������Time string. Delta-time %s parsed to %ld seconds, or in local time: %s��Time string. Delta-time %s parsed to %ld seconds �������Format...... Wkd Mon 00 00:00:00 0000 GMT ������Trying...... The Wrong time format: %s �ERROR....... Parsed illegal time: %02d.%02d.%02d %02d:%02d:%02d ��������Time string. %s parsed to %ld calendar time or `%s' in local time ������%a, %d %b %Y %H:%M:%S���%a, %d %b %Y %H:%M:%S GMT�������%d-%b-%Y %H:%M��%dK�����%.1fM���%dM�����%.1fG���%dG�����A������?P������?+@@�����?������@#?*�������file����cache���localhost�������LocalName... Not on local file system ��Node........ `%s' means path `%s' ������file:���DNS Delete.. object %p from list %p ����HTDNS_add�������HTDNS.c�DNS Add..... `%s' with %d home(s) to %p ��������DNS weight.. Home %d has weight %4.2f ��DNS weight.. Object %p not found' ������??/6A������?$Yۡ��������HostByName.. Bad argument ������HTDNS_init������HostByName.. Refreshing cache ��gethostbyname���F)>Y9TCP......... Can't find internet node name for peer!! ��TCP......... Peer name is `%s' �� �|����8�X����NoFreeStream����HTNoFree��������HTNoFree.c������HTArray_new�����HTArray.c�������HTArray_add�����HTAssoc_add�����HTAssoc.c�������HTAssoc_add: ERROR: assoc list NULL!! ��HTAtom_for������HTAtom.c��������*�������HTChunk_new�����HTChunk.c�������HTChunk_putc����HTChunk_putb����ch->data �������HTList_new������HTList.c��������HTList_addObject��������HTList...... Can not add object %p to nonexisting list �List........ Empty list or no sort algorithm ���Mem Add..... Callback %p �������Mem Delete.. Callback %p �������Mem Delete.. All Callback functions ����Mem Calling. %p (size %d) ������Memory.... Couldn't allocate %d bytes ��Memory...... Couldn't allocate %d objects of size %d ���Memory...... Couldn't reallocate %d bytes ������Memory Free. %p ��������%s:%ld failed allocation for "%s" (%ld bytes). Program aborted. ��������HTSACopy��������HTString.c������HTSACat�HTStrCpy��������HTStrCat��������%s:%ld ���������XML Parser.. FREEING... ��������XML Parser.. ABORTING... �������XML Parser.. `%s' �� ��\����dxml�����HTXML_new�������HTXML.c�XML Parser.. Stream created ����error in processing external entity reference���unclosed CDATA section��encoding specified in XML declaration is incorrect������unknown encoding��������xml processing instruction not at start of external entity������reference to external entity in attribute�������reference to binary entity������reference to invalid character number���asynchronous entity�����recursive entity reference������undefined entity��������illegal parameter entity reference������junk after document element�����duplicate attribute�����mismatched tag��unclosed token��not well-formed�no element found��������syntax error����out of memory���DOCTYPE�SYSTEM��PUBLIC��ENTITY��ATTLIST�ELEMENT�NOTATION��������NDATA���NMTOKENS��������NMTOKEN�ENTITIES��������IDREFS��IDREF���ID������CDATA���IMPLIED�REQUIRED��������FIXED���EMPTY���ANY�����PCDATA�������������������������������������������������1�������������������������������@T��?������������������������|�/���`#�����������m^������#�������#������=���������������@������������������������������ ���?����% l������������������������������������������������������?��P���1P�,b@��������?????_������L@����������������������������������������������������������?�����������������������`�������������������������?���T��{?��������������|=?��9�m^�9���;��9��=ÿ�=���`=��@`=���=����������������������%;l?_������� ?�����������������������������������������>fw�� ������������������������������������������������������������������������������������������������������������� !"#$%������������&��������������'��������������������������������������������������������������������������������CDATA[���`h�V�Dp�gp�h�q�sx�tP�u�k�n�ph�uH�j�v(�v��������������� �� ������������������   !" #����������:$�:�:�:�;H�:�:�;�< �`h�V�Dp�gp�h�q�sx�tP�u�k�n�ph�uH�j�v(�v��������������� ��������������������   !" #����������:$�:�:�:�;H�:�:�;�< �`h�V�Dp�gp�h�q�sx�tP�u�k�n�ph�uH�j�x,�x���������������� �� ������������������   !" #�������������������������������������`h�V�Dp�gp�h�q�sx�tP�u�k�n�ph�uH�j�yT�x��������������� �� ������������������   !" #����������������������������������������������������������������������������������������������������������������������������������������������������������������������t����`�l�x�P�(�8�l�������������������� �� ������������������   !" #��������������������������������������t����`�l�x�P�(�8�l������������������� ��������������������   !" #�������������������������������������h� �l��� ��$�����T�p�x�d���������������� �� ������������������   !" #�������������������������������������h� �l��� ��$�����T�p�x�d��������������� ��������������������   !" #������������������������������������ISO-8859-1������UTF-8���US-ASCII��������UTF-16���������version�encoding��������standalone������yes�����no��� /P� Tx� 5 � Tt� 5$� Th�����������������b$�����b/�����b;�����bJ��� �@��� �\���������@��� ��bT����/��� �������������� /�������������������������d��� ��� ����������������������������������������������������������00�����<0�����H0�����T0�����`0�����l0�����x0�����0�����0�����0�����0�����0�����0�����0�����0�����0�����0�����0����0����0���� 0����,0����80����D0����P0����\0����h0����t0����0����0����0����0����0����0����0����0����0����0����0����0~����0{����0x����(0u����40r����@0o����L0l����X0i����d0f����p0c����|0`����0]����0Z����0W����0T����0Q����0N����0K����0H����0E����0B�����0?���� 0<����09����$06����003����<00����H0-����T0*����`0'����l0$����x0!����0����0����0����0����0����0����0 ����0 ����0����0����0�����0����0���� 0����,0����80����D0����P0����\0����h0����t0����0����0����0����0����0����0����0����0����0����0����0����0����0����0����������� Tp����Record Nn' Vn' Fn' On' Nv Vv Fv' Ov' No' Vo' Fo' Q Se Q +P V Se V +P V FPR �Record Nx Vx Fx Qx % beats % N % V % F Total Shutdown ��Record CTs CFN CTp CFP STs SFN STp SFP LTs LFN LTp LFP CSe C+P SSe S+P LSe L+P ��������Record Nn' Sn' Vn' Fn' On' Ns Ss Vs Fs' Os' Nv Sv Vv Fv' Ov' No' So' Vo' Fo' Q Se Q +P V Se V +P S Se S +P RR err ���Record Nx Sx Vx Fx Qx % beats % N % S % V % F Total Shutdown ������(SVE run detection) ����(AF detection) �(VF detection) �(Ischemic ST detection, both signals) ��(Ischemic ST detection, signal 0) ������(Ischemic ST detection, signal 1) ������(Measurement errors) ��������������������=���P��������6��7 ���������������������������������������������������6@�6�5�5�5�5�5P�50�4�4�4�4h�4(�3�3�38�2�2�2�1���d�?��>���e�>�>����>�>����>�>����>�>����>�>����>x�>����>h�>����>X�>����>@�>��,�>(�>��-�>��>��.�=�>��/�=�>��0�=�>��1�=�>��2�=�>��3�=�>���=�=���=p�=���=X�=���=H�=���=8�=���= �=���=�=���<�=���<�=���<�=���<�=���<�=���<�=���<�=���<h�=���<P�=���<8�=���< �=���<��=���;�=���;�;���;�;���;�;���;�;���;p�;���;P�;���;0�;��� �;�;��� �:�;��� �:�;��� �:�;����:�;���c�:�;�����:�:p�����:X�:p�����:(�:p�����:�:p�����9�:p�����9�:p�����9�:p�����9�:p�����9�:p�����9`�:p�����9H�:p�����9�:p�����8�:p�����8�:p�����8�:p�����8�:p�����8p�:p�����8@�:p�����8(�:p�����7�:p�����7�:p�����7�:p�����7�:p�����7h�:p�����78�:p�����7�:p�����6�:p�����6�:p�����6X�:p�������������B`�BX�BP�����������������W�W�W�W�W��������,;:.�����^`�^X�^P�^H�^@�^8�^0�^(�^ �^�^�^�^��]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]�]x�]p�]h�]`�]X�]P�]H�]@�]8�]0�](�] �]�]�]�]��\�\�\�\�\�\�\�\�\�\�\�\�\�\�\�\�\x�\p�\h�\`�\X�\P�����^�^�^�^�^�^�^�^�^�^x�^p�^h�����^�_8�^�_0�_ �_�_��^�^�^�^�^�^p�����^�_P�^�_H�^�^p�����_�_�^�_�^�_�_�^�_0�_�_x�_p�^�_`�^�_X�^p�����`�`�`��^�_�_�_�_�^�_0�_�^�^p�_�_�����_�`�^�_�^�_�^�_0�`�^�_p�^�_`�^�^p�����_�^�����^�^�^�^�^�^p�����` �^�^�^�^�^�^p�����^�`(�^�^�^p�����_�^�^�`8�^�^�_0�^�_`�^p�_X�`0�����^�^�^�^�`H�^�^p�_�����` �^�`P�^�^�^�^�^p�����^�`p�^�`h�^�^�``�^�^p�����`�`�`�^�^�`�^�^�`x�^�^�^p�����^�^�^�^�^�^p�����`�^�^�^�^�^�^p�����^�^�`�����`�^�^�^�^�`�``�^�^p�_�����^�^�`�����`�^�_8�_�^�^�_ �_�_0�^�^�^�^�^p�_�����`�`�`�^�^�_�_�^�`�^�^�^�^�^p�`�_�_�����`�_�`�`�`�^�^�`8�^�^�`�_0�`�``�^�^�_`�^p�_X�`�`0�����^�^�^�^�a��^�^p�����_�^�^�a�^�^�^�^p�����_�`�^�^�^�^�^�^p�����^�a�^�^�^�^�^p�_X�`0�����_�^�^�_�_�^�^�a�_�_x�^�^�^p�_X�����^�^�^�^�_0�^�^p�����a8�^�a(�^�_0�a �����a@�����`�`��`�^�ap�_�a`�aX�aP�^�_�_�^�^�_0�aH�^�_`�^p�_X�`�_�_�����^�a�^�^�^�ax�^�^p�_X�����^�`8�^�^�a�^�^�^p�����^�`8�^�^�a�^�a�^�^p�`0�����^�_0�_X�`0�a�����^�^�^�^�^�^p�_�����_�a�a�^�_X�����^�^�`8�^�^�a�_0�``�^�_`�^p�����^�^�a�^p�_X�����`�^�`�a�a�^�^�a�^�^�a�a�^�^p�_�����`�b�b�^�^�^�^�^�^p�b�����bP�`�bH�^�b�b�^�b@�^�^�b8�_�^�b0�b(�b �^�^p�b�_�����^�_P�^�`8�^�^�_0�`�_H�^�_`�^p�����^�^�����^�a�^�^�^�^�^p�_X�����e � > �������bP� @ �������e� @ �������e� @ �������e� >h�������e�� >��������d� @ �������d� >��������d� ?��� �����d� >��������d� @ �������d� ?�������d� =��� ����d� ?0��������d� ?H��� ����d� @<�������d� =��������` � @ �������_� @ �������d� ?|�������d� ?|�������dx� @ ��������dp� ?��������dh� @ �������^� @ �������d`� @<�������dX� @ �������dP� @ ��������dH� @ �������d8� @ �������d0� ?��� ����d(� ?��� ����a� =��� �����d� >�������d� @<�������d� @<�������d�� @<�������c� @<�������c� @<�������c� @<�������c� @\�������c� @l��� �����c� @�������c� @ �������c� @�������c� @��������c� A0��������c� ?�������c� A��������c� @ �������a� A�������c� A�������c� A��� �����^� B��������c� BT�������cx� Bt��������cp� @ �������ch� B��������cX� @ �������cH� @ �������_� B�������c@� B��� ����c0� C �������c(� CD��� �����c � @<��������c� Cp��������c� C�������c� @ �������c�� @ �������b� @ �������b� C�������b� C��� ����b� @ �������`H� @<�������b� @ �������b� @ �������^� C�������b� @ �������b� @ �������b� D�������b� DH��� ����b� Dt��������b� D��� ����b� DH��� ����b� Dt��������b� DH��� ����^p� D�������bx� DH��� �����bp� @ �������bh� @ �������b`� E�������bX� @ ������� E,���\� <���C� J�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�fp�fh�f�f`�f�f�f�f�f�f�f�f�f�f�f�fP�fH�f8�fH�f(�fH�f�fH�f��fH�e�fH�f�f�f�f�f�f�f�f�f�f�e�f�f�f�f�f�f�f�f�f�f�f�f�f�e�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�e�e�f�f�f�f�e�f�f�f�e�ex�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�f�eh�eP�f�f�f�f�f�f�e8�e(�f�f�h�h�h�h�h�h�h�h�h�h�h�h�hx�hp�hh�h`�hX�hP�hH�h@�h8�h0�h(�h �h�h�h�h��g�g�g�g�g�g�g�g�g�g�g�g�g�g�g�g�gx�gp�gh�g`�gX�gP�gH�g@�g8�g0�g(�g8�g �g�g�h�g�g��f�f�f�f�����lp�lh�l`�lX�lP�lH�l@�l8�l0�l(�l �l�l�l�l��k�k�k�k�k�k�k�k�k�k�k�k�k�k�k�k�kx�kp�kh�k`�kX�kP�kH�k@�k8�k0�k(�k �k�k�k�k��j�j�j�j�j�j�j�j�j�j�j�j�j�j�j�j�jx�jp�jh�j`� N�������������P�������� ������������������������������������������������������������������������������?���������������������������?�������������������������������������������������������������������������������Q����@��� ��� �������0������������<�?<�@ �>�?�=x�ϐ�W�W�W@�Xt�X�Wp����������������������������� �������������������������������������������� �x��@�h����X���H���8���(����������������������������B_ ������������x��`���������������������2��������� �(���������(� ��������������������������������������������������������������������������� P� H� @� 8� 0� (�  � � � � �� ������������������������������������������������������ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/������������������������������������������������������������������������������� � p� X� H� 8� 8� (� � � � � � x� P� 0� �� � � p� X� (� � � � �� � � � �������������as: SC4.2 dev 30 Nov 1995 ��as: SC4.2 dev 30 Nov 1995 ��@(#)SunOS 5.5 Generic November 1995��as: SC4.2 dev 30 Nov 1995 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: WorkShop Compilers 4.2 dev 13 May 1996 �GCC: (GNU) 2.95.1 19990816 (release)��as: SC4.2 dev 30 Nov 1995 �GCC: (GNU) 2.95.1 19990816 (release)��as: SC4.2 dev 30 Nov 1995 �GCC: (GNU) 2.95.1 19990816 (release)��as: SC4.2 dev 30 Nov 1995 �ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning)��.interp�.hash�.dynsym�.dynstr�.rela.got�.rela.bss�.rela.plt�.text�.init�.fini�.rodata�.got�.dynamic�.plt�.data�.ctors�.dtors�.eh_frame�.bss�.symtab�.strtab�.comment�.stab.index�.stab�.shstrtab�.stab.indexstr�.stabstr������������������������������������������������������������������������������ �������������.������������������� ����/��/��\����������������������@��@��bT������������������������������$������ ������ ���)������������H������������ ���3������������������������� ���=����������H������������������C�������@�@���������������������I�������\�\���������������������O�������p�p�������������������W������� /,�/,���$�����������������\������� /P�/P�������������������e������� /�/��,�������������� ���j������� 5 �5 ��D������������������p������� Td�Td���������������������w������� Tl�Tl���������������������~������� Tt�Tt���������������������������� Tx�Tx��AL������������������������������Tx��"������������������������������v������������������